KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398679Help
Entry
100398679         CDS       T03264                                 

Gene name
CDH1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04371  Apelin signaling pathway
cjc04390  Hippo signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04520  Adherens junction
cjc05100  Bacterial invasion of epithelial cells
cjc05200  Pathways in cancer
cjc05213  Endometrial cancer
cjc05216  Thyroid cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100398679 (CDH1)
   04390 Hippo signaling pathway
    100398679 (CDH1)
   04371 Apelin signaling pathway
    100398679 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100398679 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100398679 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398679 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100398679 (CDH1)
   05216 Thyroid cancer
    100398679 (CDH1)
   05218 Melanoma
    100398679 (CDH1)
   05219 Bladder cancer
    100398679 (CDH1)
   05213 Endometrial cancer
    100398679 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100398679 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398679 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100398679 (CDH1)
   04090 CD molecules [BR:cjc04090]
    100398679 (CDH1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100398679 (CDH1)
Cell adhesion molecules [BR:cjc04515]
 Cadherins
  Major cadherins
   100398679 (CDH1)
CD molecules [BR:cjc04090]
 Proteins
  100398679 (CDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 RET_CLD1
Motif
Other DBs
NCBI-GeneID: 100398679
NCBI-ProteinID: XP_008984373
Ensembl: ENSCJAG00000015504
Position
20
AA seq 879 aa AA seqDB search
MGPLSRSHSALLLLLLLQVSYRVCQEPESCHPGFDSESYTFTVPRRHLERGRVLGRVSFE
DCTGRPRTAYFSVDTRFKVGTDGVITVKRPVQLHNPQIHFLVYAWDSTYRKFSTKVTLQA
VGHPHHDSVPESHMEVLTFPNSSHSLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKD
KEAKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREQIATYTLFSHAVSSNGNAIE
DPMEIVITVTDQNDNKPEFTQEVFHGSVMEGALPGTSVMEVSATDADDDVNTYNAAIAYT
ILSQAPELPYQKMFTINKDTGVISVLTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVI
TVTDANDNPPIFNPTTYQGQVPENEANFKIATLKVTDADAPNTPAWEAVYTILNDNEGQF
VVTTDPVTNDGILKTAKGLDFEAKQQYILHVAVTNVAPFEVSLTTSTATVIVDVLDVNEA
PIFVPLEKKVTVSEDFGVGQEITSYTAREPDTFMEQKITYRIWRDTANWLEINPDTGAIS
TRAELDRENLEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRNLYFC
ERNPEPQVINIIDADLPPNTSPFTAELTHGASANWTIEYNDPTQESLILKPKIYLEVGEY
KINLKLMDNQNKDQVTTLEVHVCDCEGTANVCRKAQYVEAGLQVPAILGILGGILALLIL
ILLLLLFLRRRTVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVT
RNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAA
SLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgggccctttgagccgcagccactccgcgctgcttctgctgctgctgctgcaggtctcg
tatagggtctgccaagagccggagtcctgccaccccggctttgattccgagagctacaca
ttcacggtgcctcggcggcacctggagagaggccgcgtcctgggcagagtgagttttgaa
gattgcactggtcgaccaaggacagcctacttttccgtcgacacccgattcaaagtgggc
acagatggcgtgattacagtcaaaaggcctgtacaacttcataacccacagatccatttt
ctggtctacgcctgggactccacctacagaaagttttccaccaaagtcacgctgcaggca
gtggggcacccccatcatgactctgttcctgaatcccacatggaagtgctcacatttccc
aactcctctcatagcctcagaagacagaagagagactgggttatccctcccatcagctgc
ccagaaaatgaaaaaggcccatttcctaaaaacctggttcagatcaaatccaacaaagac
aaagaagccaaggttttctatagcatcactggccaaggagctgacacgccccctgttggt
gtctttattattgaaagagaaacagggtggctgaaagtgacagagcctttggatagagaa
caaattgccacctacactctcttctcccatgctgtgtcatccaatgggaatgctattgag
gacccaatggagattgtgataaccgtgactgatcagaatgacaacaagcccgagttcacc
caggaggtctttcacgggtctgtcatggaaggtgctcttccaggaacctccgtgatggag
gtctcagccacagacgcagacgatgatgtgaacacctacaatgccgccatcgcttacacc
atcctcagccaagcgcctgagctgccttaccaaaagatgttcacaattaataaggacaca
ggagtcatcagtgtgctcaccaccgggctggaccgagagagtttccctacatatacgctg
gtggtccaggctgctgaccttcaaggagaagggttaagcacaacagcaacagctgtgatc
acagtcactgatgccaacgataaccctccgatcttcaatcccaccacgtaccagggtcag
gtgcccgagaacgaggctaacttcaaaatcgccacactgaaagtgactgatgctgacgcc
cccaacaccccggcgtgggaggctgtatacaccatattgaatgataatgaggggcaattt
gtcgtcaccacagatccagtgaccaacgatggcattttgaaaacagcaaagggcttggat
tttgaggccaagcagcagtacattctacatgtggcagtaacaaatgtggccccatttgag
gtctctctcaccacctccacagctactgtcatcgtggatgtgctggatgtgaatgaagcc
cccatctttgtgcctcttgaaaagaaagtgacagtgtccgaggactttggtgtgggccag
gaaatcacatcctacactgcccgggagccagacacatttatggaacagaaaataacgtat
cggatttggagagacactgccaattggctggagattaatccggacactggtgccatttcc
actcgggctgagctggacagggagaacttagagcatgtgaagaacagcacatacacagcc
ctcatcatagctacagataatggttctccagttgctactggaacagggacgcttctgctg
atcctgtctgatgtgaatgacaatgcccccataccagaaccccgaaatttgtacttctgc
gagaggaatccagagcctcaagtcatcaacatcattgatgcagaccttcctcccaataca
tctcccttcacggcagaactaacacatggggcgagtgccaactggaccattgagtacaat
gacccaacccaagaatctctcattttgaagccaaagatatacttagaggtgggtgagtac
aaaatcaatctcaagctcatggataaccagaataaagaccaagtgaccaccttagaggtt
cacgtatgtgactgtgaagggaccgccaacgtctgtcgaaaggcacagtatgtcgaagca
ggattgcaagttcctgccatcctggggattcttggaggaattcttgctttgctaatcctg
attctactgctcttgctgtttcttcggaggagaaccgtggtcaaagagcccttactgccc
ccggaggatgacacccgggacaatgtttattactatgatgaagaaggaggcggagaagag
gatcaggactttgacttgagccagttgcacaggggcctagacgctcggcctgaagtaact
cgcaacgatgtcgcaccaaccctcatgagcgttccccggtaccttccccgccctgccaat
cccgatgaaattggaaattttattgatgaaaatctgaaggcggctgatagtgaccccacg
gccccaccttatgattctctgctcgtgtttgactatgaaggaagtggttccgaagctgct
agtctgagctccctgaactcctcggagtcagacaaagaccaggactatgactacttgaac
gaatggggcaatcgcttcaagaagctggcagacatgtacggaggcggcgaggatgactag

DBGET integrated database retrieval system