KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398703Help
Entry
100398703         CDS       T03264                                 

Gene name
CDK2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04115  p53 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04218  Cellular senescence
cjc04914  Progesterone-mediated oocyte maturation
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
cjc05222  Small cell lung cancer
cjc05226  Gastric cancer
Module
cjc_M00692  Cell cycle - G1/S transition
cjc_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100398703 (CDK2)
   04151 PI3K-Akt signaling pathway
    100398703 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100398703 (CDK2)
   04114 Oocyte meiosis
    100398703 (CDK2)
   04115 p53 signaling pathway
    100398703 (CDK2)
   04218 Cellular senescence
    100398703 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100398703 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398703 (CDK2)
   05203 Viral carcinogenesis
    100398703 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100398703 (CDK2)
   05215 Prostate cancer
    100398703 (CDK2)
   05222 Small cell lung cancer
    100398703 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100398703 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100398703 (CDK2)
   05162 Measles
    100398703 (CDK2)
   05161 Hepatitis B
    100398703 (CDK2)
   05160 Hepatitis C
    100398703 (CDK2)
   05169 Epstein-Barr virus infection
    100398703 (CDK2)
   05165 Human papillomavirus infection
    100398703 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100398703 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100398703 (CDK2)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398703 (CDK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100398703 (CDK2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100398703 (CDK2)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100398703 (CDK2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100398703 (CDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100398703
NCBI-ProteinID: XP_002748513
Ensembl: ENSCJAG00000007404
UniProt: F7BWH8
Position
5
AA seq 298 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINTEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccagaaacaagttgacgggagaagttgtggcgcttaagaaaatccgcctggacactgag
actgagggtgtgcccagtactgccatccgagagatctctctgcttaaggagcttaaccat
cctaatattgtcaagctgctggatgtcattcacacagaaaataaactctacctggttttt
gaatttctgcaccaagatctcaagaaattcatggatgcctctgctctcactggcattcct
cttcccctcatcaagagctatctattccagctgctccagggcctagctttctgccattct
catcgggtcctacaccgagaccttaagcctcagaatctgcttataaacacagaagggtcc
atcaagctagcagactttggactagccagagcttttggagtccctgttcgtacttatacc
catgaggtggtcaccctgtggtaccgagctcctgaaatcctcctgggctgcaaatactac
tccacagctgtggacatctggagcctgggctgcatctttgctgagatggtgactcgccgg
gccctattccctggagattctgagattgaccagctcttccggatctttcggactctgggg
accccagatgaggtggtgtggccaggagttacttctatgcctgattacaaaccaagtttc
cccaagtgggcccgacaagattttagtaaagttgtacctcccctggatgaagatggacgg
agcctgttatcgcaaatgctgcactatgaccccaacaagcggatttcggcaaaggcagcc
ctggctcaccctttcttccaggatgtgaccaagccagtaccccatcttcgactctga

DBGET integrated database retrieval system