KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398789Help
Entry
100398789         CDS       T03264                                 

Gene name
PTTG1, securin
Definition
(RefSeq) pituitary tumor-transforming 1
  KO
K06635  securin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100398789 (PTTG1)
   04114 Oocyte meiosis
    100398789 (PTTG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100398789 (PTTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398789 (PTTG1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    100398789 (PTTG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Securin
Motif
Other DBs
NCBI-GeneID: 100398789
NCBI-ProteinID: XP_002744164
Ensembl: ENSCJAG00000019165
UniProt: F7E3V6
Position
2
AA seq 202 aa AA seqDB search
MATLIYVDKENGETGTRVAAKDGLKLGSGPSVKALKGRSQVSTPRFGKTYDAPPALPKAT
RKALGTVNRATEKSVKTSGLLNQKQPSFSAKKMTGKTVKAKSSVPASDDAYPEIEKFFPF
NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESDLLQ
SPSSILSTLDVELPPVCCDIDI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctactttgatctatgttgataaggaaaatggagaaacaggcacccgtgtggctgct
aaggatgggctgaagctggggtctggaccttcagtcaaagccttaaaggggagatctcaa
gtttcaacaccacgttttggcaaaacgtatgatgctccaccagccttacctaaagctact
agaaaggctttgggaactgtcaacagagctacagaaaagtcagtgaagaccagtggactc
ctcaatcaaaaacaaccaagcttttctgccaaaaagatgactgggaagactgttaaagca
aaaagctctgttcctgcctcagatgatgcctatccagaaatagaaaaattttttcccttc
aatcctctagactttgagagttttgacctgcctgaagagcaccagattgcacacctaccc
ttgagtggagtgcctcttatgatccttgacgaggagagagagcttgaaaagctgtttcag
ctgggccctccttcacctgtgaagatgccctctccaccatgggaatccgatctgttgcag
tctccttcaagcattctgtcgaccctggatgttgaattgccacctgtttgctgtgacata
gatatttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103792074Help
Entry
103792074         CDS       T03264                                 

Gene name
PTTG2
Definition
(RefSeq) pituitary tumor-transforming 2
  KO
K06635  securin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103792074 (PTTG2)
   04114 Oocyte meiosis
    103792074 (PTTG2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103792074 (PTTG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    103792074 (PTTG2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    103792074 (PTTG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Securin
Motif
Other DBs
NCBI-GeneID: 103792074
NCBI-ProteinID: XP_008991741
Position
3
AA seq 189 aa AA seqDB search
MATLIYVDKEXGDPGTGVAAKDGLKLXPSIKALDGRSQVLTPCFGKTFDAPPALPKATRK
ALGTVKRTTEKSVKTSGPSTQKQPRFSAQKMTKKTVKAKSSVPDSDDACFEIEKFFLFNP
LDVESSDLPEEHQIAHLPXSGVPLMILGEERELESLVQXGPPSLVNMPFPPWESHLXAVS
FKHSVDPGC
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctactctgatctatgtcgataaggaanatggagacccaggcactggtgtggctgct
aaggacgggctaaagctgngaccttcaatcaaagccttagatgggagatctcaagtttta
acaccatgttttggcaaaacattcgatgctccaccagccttacctaaagccaccagaaag
gctttgggaactgtcaaaagaacaacagaaaaatcagtaaagaccagtggacccagcaca
caaaaacagccaaggttttctgcccaaaagatgaccaagaagactgttaaagcaaaaagc
tctgttcctgactcagatgatgcctgttttgaaatagaaaaattctttctcttcaatcct
ctagacgttgagagttctgacctgcctgaagagcaccagattgcacacctcccctagagt
ggagtgcctctcatgattcttggtgaggagagagagcttgaaagcctggttcagnctggg
cccccatcactggtgaacatgccctttccaccatgggaatcccatctgnttgcggtctcc
ttcaagcattctgttgaccctggatgttga

DBGET integrated database retrieval system