KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398838Help
Entry
100398838         CDS       T03264                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04380  Osteoclast differentiation
cjc04630  Jak-STAT signaling pathway
cjc04668  TNF signaling pathway
cjc04910  Insulin signaling pathway
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05160  Hepatitis C
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
Module
cjc_M00388  ECS complex
cjc_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100398838 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100398838 (SOCS3)
   04668 TNF signaling pathway
    100398838 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100398838 (SOCS3)
   04920 Adipocytokine signaling pathway
    100398838 (SOCS3)
   04917 Prolactin signaling pathway
    100398838 (SOCS3)
  09158 Development
   04380 Osteoclast differentiation
    100398838 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100398838 (SOCS3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100398838 (SOCS3)
   04931 Insulin resistance
    100398838 (SOCS3)
  09172 Infectious disease: viral
   05164 Influenza A
    100398838 (SOCS3)
   05160 Hepatitis C
    100398838 (SOCS3)
   05168 Herpes simplex virus 1 infection
    100398838 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100398838 (SOCS3)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100398838 (SOCS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 100398838
NCBI-ProteinID: XP_002748842
Ensembl: ENSCJAG00000022289
UniProt: F7HXF7
Position
5
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSSPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVASLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgctgtgacgggcggcgaggcgaacctgctactc
agcgcggaacccgccggcacctttctcatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgcgaggggggc
agcttctctctgcagagcgacccccggagcacgcagcccgtgccccgcttcgactgtgtg
ctcaagctggtgcaccactacatgccaccccctggagccccctccttcccctcgtcacct
actgaaccctcctccgaggtgcctgagcagccgtctgcccagcccctccctgggagtccc
cccagaagagcctattacatctactctgggggcgagaagatcccgcttgtgttgagccgg
cctctctcctccaacgtggccagtcttcagcatctctgtcggaagactgtcaacggccac
ctggactcctatgagaaagtcacccagctgcccgggcccattcgggagttcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system