KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398947Help
Entry
100398947         CDS       T03264                                 

Gene name
TAB1
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05161  Hepatitis B
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100398947 (TAB1)
   04064 NF-kappa B signaling pathway
    100398947 (TAB1)
   04668 TNF signaling pathway
    100398947 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100398947 (TAB1)
   04621 NOD-like receptor signaling pathway
    100398947 (TAB1)
  09158 Development
   04380 Osteoclast differentiation
    100398947 (TAB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100398947 (TAB1)
   05161 Hepatitis B
    100398947 (TAB1)
   05168 Herpes simplex virus 1 infection
    100398947 (TAB1)
   05169 Epstein-Barr virus infection
    100398947 (TAB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100398947 (TAB1)
   05140 Leishmaniasis
    100398947 (TAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PA14
Motif
Other DBs
NCBI-GeneID: 100398947
NCBI-ProteinID: XP_002763541
Ensembl: ENSCJAG00000016297
UniProt: U3BE68
Position
1
AA seq 504 aa AA seqDB search
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNVEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTTSSAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctgcagagtgagcagcagccaagctggacagacgac
cttccgctctgccacctctctggggttggctcagcctccaaccgaagctactctgctgat
ggcaagggcactgagagccacccgccagaggacagctggctcaagttcaggagtgagaac
aactgcttcctgtatggggtcttcaacggctacgatggcaaccgggtgaccaacttcgtg
gcccagcggctgtccgcggagctcctcctgggccagctgaatgttgagcatgctgaggcc
gacgtgcggcgcgtgctgctgcaggccttcgatgtggtagagaggagcttcctggagtcc
attgacgatgccttggctgagaaggcaagcctccaatcgcaactgccagagggggtccct
cagcaccagctgcctcctcagtatcagaagatcctggagagactcaagacattggagagg
gaaatttcgggaggggccatggccgttgtggcggtccttctcaacaacaagctctacgtc
gccaatgtcggtacaaaccgtgcacttttatgcaaatcgacagtggatgggttgcaggtg
acacagctgaacgtggaccacaccacggagaatgaggacgagctcttccgcctttcacag
ctgggcttggacgccgggaagatcaagcaggtggggatcatctgtggccaggaaagcacc
cggcgcatcggggattacaaggtcaaatatggctacacggacattgaccttctcagcgct
gccaagtccaaaccaatcatcgcagagccagaaattcatggggcacagccactggatggg
gtgactggcttcctggtgctgatgtcagaggggctgtacaaggccctggaggcagcccat
gggcctgggcaggccaaccaggagattgccgcaatgattgacactgagttcgccaagcag
acctcgctcgacgcagtagcccaggcggtggtggaccgggtgaagcgcatccacagcgac
acctttgccagtggtggggaacgtgccaggttctgcccccggcacgaggacatgaccctg
ctggtgaggaactttggctacccactgggcgaaatgagccagcccacaacgagctcagcc
ccagctgcagggggacgagtgtaccctgtgtctgtgccatactccagtgcccagagcacc
agcaagaccagcgtgaccctctcccttgtcatgccctcccagggccagatggtcaacggg
gctcacagcgcttccaccctggatgaagccacccccaccctcaccaaccaaagccccacc
ttaaccctgcagtccaccaacacgcacacgcagagcagcagctccagctccgacgggggc
ctcttccgctcccggcctgcccactcactcccgcctggcgaggacggccgcgttgagccc
tatgtggactttgctgagttttaccgcctctggagtgtggaccatggcgagcagagcgtg
gtgacggcaccgtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401610Help
Entry
100401610         CDS       T03264                                 

Gene name
TAB3
Definition
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 3
  KO
K12793  TAK1-binding protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100401610 (TAB3)
   04668 TNF signaling pathway
    100401610 (TAB3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100401610 (TAB3)
   04657 IL-17 signaling pathway
    100401610 (TAB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP Tmemb_cc2
Motif
Other DBs
NCBI-GeneID: 100401610
NCBI-ProteinID: XP_008987366
Ensembl: ENSCJAG00000007710
UniProt: F7I9D6
Position
X
AA seq 712 aa AA seqDB search
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTSPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
GRQAPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLPK
GSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKP
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
EPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEEL
ERLKSEVNSMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS
RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAA
DADEHLTGSIQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaagcagcccacagcttgatattcaggttctccatgatcttcgacaacgtttc
cctgaaattccagagggcgtagtgtctcagtgcatgttacagaataacaacaatcttgaa
gcctgttgccgagccctttcccaggagagtagcaaatacttatatatggagtaccatagt
ccagatgacaataggatgaatagaaatcgccttttacatattaacctgggtatccattct
cctagtagctatcacccaggagatggagcccaacttaatggtggtcgaacactggtacac
agctcaagtgatggacatattgatccacagcatgcagcaggtaaacagctgatatgttta
gttcaagaaccacactcagctccagctgttgttgctgctactcccaactacaatccattt
tttatgaatgaacagaacagaagtgcagctactcctccttcacagccacctcaacagcca
tcttccatgcaaacaggaatgaatccgtctgctatgcaagggccttcaccaccaccgcca
cctccttcatacatgcacatacctcggtatagtacaagtccaattactgttacagtatcc
cagaaccttccttctggacagactgtaccaagagctttacaaattcttccacaaattcca
agcaatctctatgggtctcctggttctatttatattagacagacatctcagagttcatca
ggaagacaagctcctcagagtacgccgtggcagtcctcaccacagggcccagtgcctcac
tatagccagcgtcctttacctgtttatccacaccaacagaactatcaaccttctcagtat
tctcccaaacagcagcagatccctcagtctgcttaccattcaccacctccttctcaatgt
ccttcacccttcagctctccacagcatcaagtgcaaccttcccagttgggccacatcttt
atgccacctagtccttcaactactccaccccatccatatcaacaaggacctcctagctat
cagaaacagggaagccattcagtagcctatcttccatacacagcatctagcttacccaaa
ggttccatgaagaagatagaaattacagttgaaccttctcagagacctgggacagcaatt
aataggagtccttcacccatcagtaatcaaccgtctccacggaatcaacactcactctac
acagccaccacaccaccttcaagttctccttcgagagggatatctagtcaaccaaaacct
ccatttagtgttaatcctgtgtatattacatatacacagccaactggaccttcatgtact
ccatcaccatctcctcgagtgataccaaacccaactacagtttttaaaattactgtaggc
cgagcaacgactgaaaatcttttaaatttagtggaccaagaagagcgctctgcggcacca
gaacctattcagcccatttcagtgataccaggctctgggggagaaaagggaagccataaa
tatcagaggagttctagttctggatcagatgactatgcctacacacaagccttgctgtta
catcaacgagcaaggatggagaggttagcaaagcaattgaaacttgagaaagaggagcta
gagcgattgaagtccgaagttaacagtatggagcatgacctgatgcagagacggctcaga
agagtcagctgcaccactgcgatccctacgcctgaggaaatgacaagattgagaagcatg
aacagacaactccagataaatgttgactgtacactgaaagaagttgacctccttcaatct
agaggaaactttgatccaaaagccatgaataatttttatgacaacatagaacctggccca
gttgtaccacccaagccatctaaaaaagactcctcagacccctgcacaattgagagaaaa
gcccgaagaattagcgtgacctccaaagtacaggcagacatccatgacacccaggcagca
gatgcagatgagcatctaactggctccatacaaagtcctcggacacaacctcgagatgaa
gactatgaaggggctccatggaattgtgatagctgcacctttcttaaccacccagcacta
aatcgctgtgagcagtgtgagatgccacggtacacctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414129Help
Entry
100414129         CDS       T03264                                 

Gene name
TAB2
Definition
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100414129 (TAB2)
   04064 NF-kappa B signaling pathway
    100414129 (TAB2)
   04668 TNF signaling pathway
    100414129 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100414129 (TAB2)
   04621 NOD-like receptor signaling pathway
    100414129 (TAB2)
   04657 IL-17 signaling pathway
    100414129 (TAB2)
  09158 Development
   04380 Osteoclast differentiation
    100414129 (TAB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100414129 (TAB2)
   05162 Measles
    100414129 (TAB2)
   05161 Hepatitis B
    100414129 (TAB2)
   05168 Herpes simplex virus 1 infection
    100414129 (TAB2)
   05169 Epstein-Barr virus infection
    100414129 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100414129 (TAB2)
   05140 Leishmaniasis
    100414129 (TAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP DLP_helical DivIC
Motif
Other DBs
NCBI-GeneID: 100414129
NCBI-ProteinID: XP_008993470
Ensembl: ENSCJAG00000019580
UniProt: F7GDZ4
Position
4
AA seq 693 aa AA seqDB search
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGNRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSSHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSSSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANATTGDEQVIRNQPTLFISTNSGASAAAR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cccgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcggatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcaatcacagaacatttaccaccatggaagagaaggaaatagaatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcttctggtgcctcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaaca
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaac
cccatgaaccctcagcaagtttatcaaccttcgcagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcaaggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccaccaaccattcattca
tctggtagctcacagtcttcttcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaacaattcttcaaaa
ctgcgttcttccggacctcgaacttctagcagttcctcttcagtcaacagccagacctta
aatagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagctaatgccaccacaggagatgaacaggtc
atacggaatcagcccacactcttcatatccacaaactctggagcatctgctgctgccagg
aacatgtctgggcaagtgagcatggggcctgcctttattcaccaccaccctcccaaaagt
cgagcaataggcaataactctgcaacctctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtttctcccaataaaccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttctaaaccatcctgatcattatgtagaaaca
gagaatattcagcacctcacagacccgacattagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctctgttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagttggataag
ttaaaatctgaggtcaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccagataccttctctcgaagaaatgcagcagttgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaatcccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtactgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgccaaggcatttctga

DBGET integrated database retrieval system