KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399012Help
Entry
100399012         CDS       T03264                                 

Gene name
TLR4
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04145  Phagosome
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100399012 (TLR4)
   04066 HIF-1 signaling pathway
    100399012 (TLR4)
   04151 PI3K-Akt signaling pathway
    100399012 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100399012 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    100399012 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100399012 (TLR4)
   04621 NOD-like receptor signaling pathway
    100399012 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100399012 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100399012 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100399012 (TLR4)
   05321 Inflammatory bowel disease (IBD)
    100399012 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100399012 (TLR4)
   05133 Pertussis
    100399012 (TLR4)
   05134 Legionellosis
    100399012 (TLR4)
   05152 Tuberculosis
    100399012 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100399012 (TLR4)
   05162 Measles
    100399012 (TLR4)
   05164 Influenza A
    100399012 (TLR4)
   05161 Hepatitis B
    100399012 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100399012 (TLR4)
   05144 Malaria
    100399012 (TLR4)
   05145 Toxoplasmosis
    100399012 (TLR4)
   05140 Leishmaniasis
    100399012 (TLR4)
   05142 Chagas disease (American trypanosomiasis)
    100399012 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100399012 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cjc04054]
    100399012 (TLR4)
   04090 CD molecules [BR:cjc04090]
    100399012 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100399012 (TLR4)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100399012 (TLR4)
Pattern recognition receptors [BR:cjc04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100399012 (TLR4)
CD molecules [BR:cjc04090]
 Proteins
  100399012 (TLR4)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Hyaluronan
  Cell surface receptors
   100399012 (TLR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_9 LRR_6 DUF1863 Curto_V2
Motif
Other DBs
NCBI-GeneID: 100399012
NCBI-ProteinID: XP_017831300
Ensembl: ENSCJAG00000020384
UniProt: A0A2R8M246
Position
1
AA seq 832 aa AA seqDB search
MMPASCLAGILIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNIPFSTKNLD
LSFNPLRHLGSHSFFNFPELQVLDLSRCEIQTIEDGAYQNLSHLSTLILTGNPIQNLALG
AFYGLSSLQKLVAVETHLLSLENFPIGHLKTLKDLNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNNIQNIYCQDLQVLHQMPLLNLSLDLSLNPINFIQPGAFKEIRLRKLTLRNNFDSL
NVMKTCIRGLAGLEVHRLVLGEFRNERNIEDFDKSALEGLCNLSIKEFRLAHLDDFPDDI
IDLFNCLANVSSFSLVSVYIKRIEDFSYNFRWQHLELVNCKFEQFPPLELKSLKRLTFTA
NKGGNPFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNDVITMGSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLFSLKVLKMAG
NSFQKNFLPDIFTDLNNLIFLDLSECQLEQVSPTAFDSLPRLQVLNMSHNNFFALDTFPY
KHLYSLQVLDYSLNHIGTSKNQELQRFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRRL
LVKVEQMECASPLNRKGIPVLSLNITCQMSKTIIGVSVLSVFVVSVVALLVYKFYFHLML
LAGCIKYGRGENTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFHLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKSLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLNGRPWSPEGAVGAGCN
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgcttcatgcctggctgggattctgatcccagccatggcattcctctcctgc
gtgagaccagaaagctgggagccctgcgtggaggtggttccaaacattacttatcaatgc
atggaactgaatttctacaaaatccctgacaacatccccttctcaaccaagaacctggac
ctgagctttaaccccctgaggcatttaggcagccatagcttcttcaatttcccagaactg
caggtgctggatttatccaggtgcgaaatccagacaatcgaagatggggcatatcagaac
ctaagccatctctccaccttaatattgacaggaaatcctatccagaatttagccctggga
gccttttatggactatcaagtttacagaagctggtggctgtggagacacatctgttatcg
ctagagaacttccccattggacatctcaaaactttgaaggaccttaatgtagctcacaat
ctaatccaatctttcaaattacctgagtatttttctaatttgaccaatctagagcactta
gacctttctagtaacaatattcaaaatatttattgccaagacttgcaggttctacatcaa
atgcccctactcaatctctctttagacctgtccctgaaccctataaactttattcaacca
ggtgcatttaaagaaattaggctccgtaagctgactttgagaaataattttgatagttta
aatgtaatgaaaacttgcattcgaggtctggctgggttagaagtccatcgtctggttctg
ggagaatttagaaatgaaagaaatattgaagactttgacaaatctgctctggagggcctg
tgcaatttgagcatcaaagaattccgattagcacacttagatgactttccggatgatatt
attgacttatttaattgtttggcaaatgtttcttcattttccctggtgagtgtgtatatt
aaaagaatagaagacttttcttataatttcagatggcaacatttagagttagtcaattgt
aaatttgaacagtttcctccactggaactcaaatctctcaaaaggcttactttcactgcc
aacaaaggtgggaatcctttttcagaagttgatctgccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaatctgattttgggacaaccagc
ctaaagtatttagatctgagcttcaatgatgttattaccatggggtcaaacttcttgggc
ttagaacaactagaacacctggatttccagcattccaatttgaaacaaatgagcgagttt
tcagtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatctttaatggcttgttcagtctcaaagtcttgaaaatggctgga
aattctttccagaaaaacttccttccagatatcttcacagatctgaataacttgatattc
ctggacctctctgagtgtcaactggagcaggtgtctccaacagcatttgactcacttccc
agacttcaggtactaaatatgagccacaacaacttctttgcattggatacatttccttat
aagcatctctactccctccaggttctggattacagtctcaatcacatagggacttccaaa
aatcaggaactacagcgttttccaagtagtctagctttcctaaatcttactcaaaatgac
tttgcttgtacttgtgaacaccagagtttcctgcagtggatcaaggaccagaggcggctc
ttggtgaaagttgaacaaatggaatgtgcatctcctttaaataggaagggcatacctgtg
ctgagtttgaatatcacctgtcagatgagtaagaccatcattggtgtgtcagtgctcagt
gtgtttgtggtatctgttgtagcacttttggtctataagttctattttcacctgatgctt
cttgctggctgcataaagtatggtagaggtgaaaacacctatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgaactagtaaagaatttagaagaaggggtg
cctccctttcatctctgccttcactacagagactttattcctggtgtggccattgctgcc
aacatcatccatgaaggtttccataaaagccgaaaggtgattgttgtggtatcccagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttctg
agcagtcgtgctggtatcatcttcattgtcctgcagaaggtggagaagtccctgctcagg
cagcaggtggagctgtaccgccttctcagcaggaacacttacctggaatgggaggacagt
gtcctggggaggcacatcttctggagacgactcagaaaagccctgctaaatggtagaccg
tggagtccagaaggagcagtgggtgcaggatgcaattag

DBGET integrated database retrieval system