KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399116Help
Entry
100399116         CDS       T03264                                 

Gene name
ALDH6A1
Definition
(RefSeq) aldehyde dehydrogenase 6 family member A1
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00280  Valine, leucine and isoleucine degradation
cjc00410  beta-Alanine metabolism
cjc00562  Inositol phosphate metabolism
cjc00640  Propanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100399116 (ALDH6A1)
   00562 Inositol phosphate metabolism
    100399116 (ALDH6A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100399116 (ALDH6A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100399116 (ALDH6A1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     100399116 (ALDH6A1)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     100399116 (ALDH6A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 100399116
NCBI-ProteinID: XP_009004577
Ensembl: ENSCJAG00000020412
UniProt: A0A2R8MKK4
Position
10
AA seq 533 aa AA seqDB search
MAAVVAAAAVRARILQVSSKVKSPWYSASPFSSSVPTVKLFIDGKFVESKSDKWIDIHNP
ATNEVIGRVPQATKAEMDAAIVSCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIAKL
ITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCAGI
APFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATILLAKLLQDSGAPDGTLNIIHGQH
EAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKENTL
NQLVGAAFGAAGQRCMALSTAILVGEARKWLPELVERAKNLRVNAGDQPGADLGPLITPQ
AKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPV
LVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMF
SFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtggcggcggcggcagtgcgagcccggatcctgcaggtttcttccaaa
gtgaaatccccctggtattcagcatctcccttctcttcgtcagtgccaactgtaaagctc
ttcattgatgggaaatttgttgaatccaaaagtgacaaatggatcgatatccacaaccca
gccaccaatgaggtaattggtcgggtccctcaggccaccaaggcagaaatggatgcagcc
attgtttcctgcaaacgtgcttttcctgcatgggcagacacttcaatattaagccgtcag
caggtcttgctccgctatcaacaacttattaaagaaaacttgaaagaaattgccaagtta
atcacattggaacaagggaagaccctagctgatgctgaaggagatgtatttcgaggcctt
caggtggttgagcatgcctgtagtgtgacatccctcatgatgggagagaccatgccatcc
atcaccaaagacatggacctttattcctatcgtctgcctctgggagtgtgtgcaggcatt
gctccattcaattttcctgccatgatccccctttggatgtttcccatggcgatggtgtgt
ggaaataccttcctaatgaaaccatccgagcgagtccctggagcaactatacttcttgct
aagttgctccaggattctggtgcccctgatggaacattaaatatcatccatggacaacat
gaagctgtaaattttatttgcgatcatccggacattaaagcaatcagctttgtgggatcc
aaccaggcaggagagtatatcttcgagagaggatcaagacatggcaagagggttcaagcc
aatatgggagccaagaaccatggggtagtcatgccagatgccaataaggaaaataccctg
aaccagctggttggggcagcatttggagctgctggtcagcgctgcatggctctttcaaca
gcaatccttgtgggagaagctaggaagtggctgccagagctggtggagcgtgccaaaaac
ctgagagtcaatgcaggagatcagccaggagctgatcttggccctctgatcactccccag
gccaaagagcgagtctgtaatctgattgatagtggaacaaaggagggagcttccatcctt
cttgatggacgaaaaattaaagtgaaaggctatgaaaatggcaacttcgttggaccaact
atcatctcgaatgtcaagccaaatatgacctgttacaaagaggagatttttggtccagtt
cttgtggttctggagacagaaacattggatgaagccatccagattgtaaacaacaaccca
tatggaaatggaactgctattttcaccaccaatggagccactgctcggaaatatgcccac
ctggtggacgttggacaggtgggagtgaatgttcccattccagtgcctttgccaatgttc
tcattcaccggctctcgatcctccttcagaggagacacgaatttctatggcaaacagggc
atccaattctacactcagttaaagaccattacttctcaatggaaagaagaagatgctaca
ctttcctcacctgctgtcgtcatgcctaccatgggccgttag

DBGET integrated database retrieval system