KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399191Help
Entry
100399191         CDS       T03264                                 

Gene name
ERCC1
Definition
(RefSeq) ERCC excision repair 1, endonuclease non-catalytic subunit
  KO
K10849  DNA excision repair protein ERCC-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03420  Nucleotide excision repair
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100399191 (ERCC1)
   03460 Fanconi anemia pathway
    100399191 (ERCC1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100399191 (ERCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100399191 (ERCC1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100399191 (ERCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10 HHH_5 HHH HHH_2 FliG_N
Motif
Other DBs
NCBI-GeneID: 100399191
NCBI-ProteinID: XP_008986460
Position
22
AA seq 270 aa AA seqDB search
MRFPPAVAKPLFKSTKSLPTVDTSAQAAPQTYAEYVMSRPPGGPEASCPTGSETLAGETC
NQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNL
HPDYIHERLQNLGKNFALRVLLIQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRY
LETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASR
EDLALCPGLGPQKARRLFDVLHEPFLKVPR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcggttccctcctgcagtggccaagcctttattcaaatccacaaagagccttcccact
gtggacacctcggctcaggcggcccctcagacctatgctgaatatgtcatgtcacggcct
ccaggagggcctgaggcttcgtgtcccacagggtcagagacactggcaggagagacctgc
aaccaggccctgaaaccaggggcaaaatccaacagcatcattgtgagccctcggcagagg
ggcaatcccgtactgaagttcgtacgcaatgtgccctgggaatttggcgatgtaatccct
gactatgtgctgggccagagcacctgtgccctgttcctcagcctccgctaccacaacctg
cacccggactacatccatgagcggctgcagaacctggggaagaacttcgcccttcgggtc
ctgctcatccaggtggatgtgaaagatccccagcaggccctcaaggagctggctaagatg
tgcatcctggccgactgtacgctgatcctcgcctggagccctgaggaagctgggcggtac
ctggagacctacaaggcctatgagcagaaaccagcggacctcctgatggagaagctagag
caggacttcgtctcccgggtgactgaatgtcttaccaccgtgaagtcagtcaacaaaacg
gacagccagaccctcctgaccacatttgggtctctggaacagctcattgctgcgtcgaga
gaagatctggccttatgcccaggactgggccctcagaaggcccggaggctgtttgatgtc
ctgcatgagcccttcttgaaagtgcccagatga

DBGET integrated database retrieval system