KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399222
Entry
100399222         CDS       T03264                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100399222 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100399222 (ASIC1)
Ion channels [BR:cjc04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100399222 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 100399222
NCBI-ProteinID: XP_017831535
Ensembl: ENSCJAG00000021071
Position
9
AA seq 528 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPIIDQLGFGVAPGFQTLXGCQEQRLIYLPPPWGTCKAVTMDSDLD
FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY
CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA
DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcactgtgggccctgtgcttcctgggctcactggctgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggta
gctgcctctcagctcaccttccctgctgtcacgctgtgtaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgccggggagctgctggctctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcaactggagatattgcaggac
aaagccaacttccgaagcttcaaacccaaacccttcaacatgcgtgagttctacgaccga
gctgggcatgacattcgagacatgctgctctcctgccacttccggggggaggtctgcagc
gctgaagacttcaaggtggtcttcacacgatatggaaagtgctacacgttcaactcgggc
cgagatgggcggccgcggctgaagaccatgaagggtgggacaggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacgtcc
tttgaagcaggcatcaaagtgcagatccatagtcaggatgaacctcctatcatcgaccag
ctgggctttggcgtggccccaggcttccagactttgnntggctgccaggagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggactcggatttggat
ttcttcgactcctacagcatcaccgcctgccgcatcgactgtgagacccgctacctggtg
gagaactgcaactgccgcatggtgcacatgccaggggatgccccatactgtactccagag
cagtacaaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtac
tgcgtgtgtgaaatgccttgcaacctgacccgctatggcaaggagctgtccatggtcaag
atccccagcaaagcctcagccaagtacctggccaagaagttcaacaagtctgagcaatac
ataggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccatt
gaacagaagaaggcctatgagattgcagggctcctgggtgacatcgggggccagatgggg
ctgttcatcggggccagcatcctcacggtgctggagctctttgactacgcctacgaggtc
ataaagcacaagctgtgccgacgaggaaagtgccagaaggaggccaaaaggagcagcgca
gacaagggcgtggccctcagcctggacgacgtcaaaagacacaacccatgcgagagcctc
cggggccaccctgccgggatgacatacgctgccaacatcctacctcaccatccggcccga
ggcacgttcgaggactttacctgctga

DBGET integrated database retrieval system