KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399291Help
Entry
100399291         CDS       T03264                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin 12 receptor subunit beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100399291 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100399291 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100399291 (IL12RB1)
   04659 Th17 cell differentiation
    100399291 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399291 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100399291 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100399291 (IL12RB1)
   04090 CD molecules [BR:cjc04090]
    100399291 (IL12RB1)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL6/12 receptor family
   100399291 (IL12RB1)
CD molecules [BR:cjc04090]
 Proteins
  100399291 (IL12RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind
Motif
Other DBs
NCBI-GeneID: 100399291
NCBI-ProteinID: XP_017822790
Position
22
AA seq 699 aa AA seqDB search
MAGDQQQGVGQGQPMRWLGDSGSECVGITKICPSNEEPSRLWSVPKPTGSLPGSASGPRN
LSCYRIPSAGYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLRFSDQARVPVLC
TVTLWVESRARNQTEKSANVTLQLYDSVRYEPPLGDIKVSKSAGQLRLEWETPDKQLRAE
VHFRRRTHGSPWKLGDCGPQDGDTESCLCPLEMNVAQEFQLRRRYRENQGSLWSKWSSPV
CVPPENPPPPQVRFLVEQLGRDGRRRLTLKEPPTQLELPEGCRGPASGMEVTYRVRLHML
SCPCKAKATRTVHLGKTLNLSGSAYNVTVISWNRFGPGPNQTWHIPADTHTGASSGWGGW
HEGPSELSTYSEPQLDQNEMSEAGNIKGVPNFRGMSKIQYLPATYSWSREFGAMEQEKCY
YITILASAHPEKLTLWSTVLSAYHFGGNASAAGTPPHVSVKNHSSDSVSVDWAPSLLSTC
PGVLKEYVVRCRDEDRKQVSEQHVQPTETQVTLRGLRAGVAYTVQVRADTVWLRGAWSQP
QRFSIEIQGSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFTG
GKETWQWINPVDFQEEASLQEALVVELSWDKGEGTEPPEKTEQPEGAPELALDAELSLED
GGRCKAKVLGLSEPDGQGCNPAQVGARHPSLLGDPGLEA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggctggagaccagcagcagggagtgggccaggggcagcccatgaggtggcttggagat
agtggcagtgagtgtgtaggcatcaccaagatttgtcccagcaacgaagagccctccaga
ctctggtctgttcccaagcccacaggatctcttccaggctcagcctccggccccagaaac
ctgagctgctatcggatacccagtgctggatacgagtgctcctggcagtatgagggtccc
acggctggggtcagccacttcttgaggtgctgccttagctccgggcgctgttgctacttc
gccgcaggctcagccacgcggctgcggttctccgaccaggccagggtgcctgtgctgtgc
actgttacactctgggtggaatcccgggccaggaaccagacagagaagtctgctaatgtg
accctgcagctctacgactcagttagatacgagccacctctgggagacatcaaggtgtcc
aagtcggccgggcagctgcgtctggagtgggagaccccagacaaacagcttcgtgctgag
gtgcacttccggcgccggacacacggcagcccgtggaagctgggtgactgcggacctcag
gatggtgatactgagtcctgcctctgccccctggagatgaatgtggcccaggaattccag
ctccgacgacggtaccgggagaaccagggaagtctctggagcaagtggagcagccctgtg
tgcgttccccccgaaaaccccccaccacctcaggtgaggttcttggtggagcagctgggc
cgggatggcaggaggcggctgaccctcaaagagccgccaacccagctggagcttccagaa
ggctgtcgagggccggcgtctggcatggaggtcacctaccgagtgcgcctccacatgctt
tcctgcccatgtaaggccaaggccaccaggaccgtgcacctgggaaaaacgctcaatctc
tccggttctgcctacaacgtgactgtcatctcctggaaccgatttggtcctggcccgaac
cagacgtggcacattcctgctgacacccacacaggtgcctcctctgggtggggagggtgg
catgagggcccctcagagctgagcacctactctgagcctcagctagaccagaatgagatg
agtgaggcgggaaatattaagggagtgcctaattttaggggtatgtcaaaaattcagtat
cttccagcaacctacagctggagtcgagagtttggggcaatggagcaggaaaagtgttac
tacattaccatcttggcctctgcgcacccagagaagctcaccttgtggtctacggttctg
tctgcctaccactttggaggcaatgcctcagcggctgggacgccaccccacgtctcggtg
aagaatcacagctcggactcggtgtctgtggactgggcaccatctctgctgagcacctgt
cccggcgtcctgaaggagtatgtcgtccgctgccgagatgaagacagaaagcaggtgtca
gagcagcacgtgcagcccacagagacccaagttaccctccgcggcctgcgggctggtgtg
gcctacacagtgcaggtgcgagcagacaccgtgtggctgaggggggcctggagccagccc
cagcgcttcagtatcgaaattcagggttctgattggctcatcttcttcgcctccctgggg
agcttcctgagcatccttctggtgggcgtccttggctacctcggcctgaacagagccgca
cggcacctgtgcccacccctgcccacaccctgtgccagctctgccattgagtttactgga
gggaaggagacttggcagtggatcaacccagtggacttccaggaagaggcatccttgcag
gaggccctggtggtggagctgtcctgggacaaaggcgagggcactgaacctcctgagaag
acagagcaacctgagggtgcccctgagctggccctggatgcagagctatccttggaggat
ggcggcaggtgtaaggccaaggtcctggggctcagtgagccggatggtcaggggtgcaac
cctgcccaggtgggggctagacacccatcgctcctgggagatccaggcctggaggcctga

DBGET integrated database retrieval system