KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399326Help
Entry
100399326         CDS       T03264                                 

Gene name
ST6GALNAC5
Definition
(RefSeq) ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
  KO
K03375  N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7E) [EC:2.4.99.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00604  Glycosphingolipid biosynthesis - ganglio series
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100399326 (ST6GALNAC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cjc01003]
    100399326 (ST6GALNAC5)
Enzymes [BR:cjc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     100399326 (ST6GALNAC5)
Glycosyltransferases [BR:cjc01003]
 Terminal extension
  Sialyltransferase
   100399326 (ST6GALNAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 ATP19
Motif
Other DBs
NCBI-GeneID: 100399326
NCBI-ProteinID: XP_002751035
Ensembl: ENSCJAG00000006833
UniProt: U3CCQ0
Position
7
AA seq 330 aa AA seqDB search
MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQTSATGSSQPAAESSPQP
RPGVPAGPRTLDGYLGVADHKPLKMHCRDCALVTSSGHLLHGRQGSQIDQTECVIRMNDA
PTRGYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVY
NNLQLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCD
RINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDECTMYLSHERGRKGSHHRFITEKRVFKN
WARTFNIHFFQPDWKPESLAINHPENKPVF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctgatgcgccatggtctggcagtgtgtttagcgctcaccaccatgtgcacc
agcttgttgctcgtgtacagcagcctcggcggccagaaggaacggcccccgcagcagcag
cagcagcagacgtcggccaccggcagctcgcagccggcggcggagagcagcccccagccg
cgccccggggtcccagcgggacctcggacactggacggatacctcggtgtggcggaccac
aagcccctgaaaatgcactgcagggactgtgccctggtgaccagctcagggcatcttctg
cacggtcggcaaggctcccagattgaccagacagagtgtgtcatccgcatgaatgacgcc
cccacacgcggctatgggcgtgacgtgggcaatcgcaccagcctgagggtcatcgcgcat
tccagcatccagaggatcctccgcaaccgccacgacctgctcaacgtgagccagggcacc
gtgttcatcttctggggccccagcagctacatgcggcgggatggcaagggccaggtctac
aacaacctgcagctcctgagccaggtgctgccccggctgaaggccttcatgattactcgt
cacaagatgctacagttcgatgagctcttcaagcaggagactggcaaagacaggaagata
tccaacacttggctcagcactggctggttcacaatgacaattgcactggagctctgtgac
aggatcaatgtttatggcatggtgcccccagacttctgcagggatcccaatcacccttca
gtaccttatcattattatgaaccttttggacctgatgaatgtacaatgtacctctcccat
gaacgaggacgcaagggcagtcatcaccgctttatcacagagaaacgagtctttaagaac
tgggcacggacattcaatattcacttttttcaaccagactggaaaccagaatcacttgct
ataaatcatccagagaataaacctgtcttctaa

DBGET integrated database retrieval system