KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399491Help
Entry
100399491         CDS       T03264                                 

Gene name
TNFSF13B, TNLG7A
Definition
(RefSeq) tumor necrosis factor superfamily member 13b
  KO
K05476  tumor necrosis factor ligand superfamily member 13B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100399491 (TNFSF13B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100399491 (TNFSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100399491 (TNFSF13B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100399491 (TNFSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100399491 (TNFSF13B)
   04090 CD molecules [BR:cjc04090]
    100399491 (TNFSF13B)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100399491 (TNFSF13B)
CD molecules [BR:cjc04090]
 Proteins
  100399491 (TNFSF13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 100399491
NCBI-ProteinID: XP_002742579
Ensembl: ENSCJAG00000014666
UniProt: F7FUZ6
Position
1
AA seq 285 aa AA seqDB search
MDDSTEREQSRLTSCLKKREEMKLKECISILPQKESPSVRYSKDGKLLAATLLLALLFCC
LTVVSFYQVATLQRDLASLRAELQGHHSEQLPAGAGAPKATLEEAPAVTMGLKIFEAPAP
GEGNPSQSSRKKRAIQDPEETVTQDCLQLIADSATPTIQKGSYTFIPWLLSFKRGSALEE
KENKILVKETGYFFIYGQVLYTDKTYSMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETQ
PSNSCYSAGIAKLEEGDELQLAIPRENAQILLDGDATFFGAFKLL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggatgactccacagaaagggagcagtcacgccttacttcttgccttaagaaaagagaa
gaaatgaaattgaaggagtgtatttccatcctcccacagaaggaaagcccctctgtccga
tactccaaagacggaaagcttctggctgcaaccttgctgctggcactgctgttctgctgc
ctcacggtggtgtctttctaccaagtggccacactgcaaagggatctggccagcctccgg
gcagagctgcagggccaccactcagagcaactgccagcaggggcgggagcccccaaggcc
accctggaggaagctccagctgtcaccatgggactgaaaatctttgaagcaccagctcca
ggagaaggcaaccccagtcagagcagcaggaagaagcgtgccattcaggatccagaagaa
acagtcactcaagactgcttgcaactgattgcagacagtgcaacaccaactatacaaaaa
ggatcttacacatttattccgtggcttctcagctttaaaaggggaagtgcccttgaagaa
aaagagaataaaatattggtcaaagaaactggttacttttttatatatggtcaggtttta
tacacggataagacctattccatgggacatctgattcagaggaaaaaagtccatgtcttt
ggagatgaattgagtctggtgactttgtttcgatgtattcaaaatatgcctgaaacacaa
cccagtaattcctgctattcagctggcatagcaaagctagaagaaggtgatgaactccaa
cttgcaataccacgagaaaatgcacaaatattactggatggagatgccacattttttggt
gcattcaaactgctgtga

DBGET integrated database retrieval system