KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399591Help
Entry
100399591         CDS       T03264                                 

Gene name
BDKRB2
Definition
(RefSeq) bradykinin receptor B2
  KO
K03916  bradykinin receptor B2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04610  Complement and coagulation cascades
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc05142  Chagas disease (American trypanosomiasis)
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100399591 (BDKRB2)
   04071 Sphingolipid signaling pathway
    100399591 (BDKRB2)
   04022 cGMP-PKG signaling pathway
    100399591 (BDKRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100399591 (BDKRB2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100399591 (BDKRB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100399591 (BDKRB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100399591 (BDKRB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100399591 (BDKRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399591 (BDKRB2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100399591 (BDKRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100399591 (BDKRB2)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Peptide
   Bradykinin
    100399591 (BDKRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 100399591
NCBI-ProteinID: XP_002754308
Ensembl: ENSCJAG00000006399
Position
10
AA seq 389 aa AA seqDB search
MFSPWKIPMFLSVREDSAPTTASFSADMLNVTLPTLNGTFAQRKCPNVEWLGWLNTIQPP
FLWVLFVLASLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILAFGLPFWAITIANNFD
WLFGETLCRVVNAIIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIW
GCTLLLSSPMLVFRTLKEYSDEGHNVTACVIIYPSRTWEVFTNMLLNVVGFLLPLIIITF
CTVQIMQVLRNNEMQKFKDIQTERRATMLVLVVLLLFVICWLPFQISTFLDTLQRLSLLS
SCQDESIIDIITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIP
MENSMGTLRTSISVERQIHKVQDWAGSRR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgttctctccctggaagataccaatgtttctgtctgttcgtgaggactctgcgcccacc
acagcctctttcagtgccgacatgctcaatgtcaccttgcccactcttaatgggaccttt
gcccagagaaaatgtcccaacgtggagtggctgggctggctcaacaccatccagccccct
ttcctctgggtgctgtttgtcctggccagcctagagaacatctttgtcctcagtgtcttc
tgcctgcacaagagcagctgcacagtggcagagatctacctggggaacctggccgcggca
gacctgatcctggccttcgggctgcccttctgggccatcaccatcgccaacaacttcgac
tggctctttggggagacgctctgccgcgtggtgaacgccattatctatatgaacctgtac
agcagtatctgtttcctgatgctagtcagcatcgaccgctacctggccctggtgaaaacc
atgtccatgggccggatgcgcggcgtgcgctgggcgaagctctacagcttggtgatctgg
gggtgcacgctgctcctgagctcacccatgctggtgttccggaccttgaaggagtatagc
gatgagggccacaatgtcaccgcttgcgtcatcatctacccatcccgcacctgggaggtg
ttcaccaacatgctcctgaatgtcgtgggcttcctgctgcccctaatcatcatcaccttc
tgcacggtacagatcatgcaggtgctgcggaacaatgagatgcagaagttcaaggacatt
cagacagagaggagggccaccatgctggtcctggtcgtgctgctgctcttcgtcatctgc
tggctgcccttccagatcagcaccttcctggacacgctgcagcgcctcagcctcctctcc
agctgccaggatgagagcatcatagatatcatcacgcagatcgcctccttcatggcctat
agcaacagctgcctcaacccactggtatatgtgatcgtgggcaagcgcttccgaaagaag
tcttgggaggtgtaccagggagtgtgccagaaagggggctgcaggtcagaacccattccg
atggagaactccatgggcacactgcggacctccatctcagtggaacgccagattcacaaa
gtgcaggactgggccgggagcagacggtga

DBGET integrated database retrieval system