KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399595Help
Entry
100399595         CDS       T03264                                 

Gene name
PIK3C2A
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100399595 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100399595 (PIK3C2A)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     100399595 (PIK3C2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 100399595
NCBI-ProteinID: XP_002807364
Ensembl: ENSCJAG00000009472
UniProt: F7ILS1
Position
11
AA seq 1686 aa AA seqDB search
MAQISSNSGVKQCPSSHLEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSS
TRQKTQVYNKQDYDLMVFPESDSQKRTLDIDVEKLTQAELEKLLLDDSFETRKTPVLPVT
PVLSPSFSAQLYFRPTIQRGQWPPGLSGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFP
STEPIYLSLPGQSPYFSYPLTSATPFHPQGSLPICRPVVSPDMAKLFDKIASTSEFLKNG
KARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLE
KDPWDAVLLEERSPANCHLERKVNGKSLSVATVTRSQSLNIRTSQLAKVQSHIFQKDPNG
TSSLPTSSSLLQEVEVQNEEMAAFCQSITKLKTKFPYTNHRTNPGYLLSPVTLQRNICGE
NASVKVSIEIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEV
LQNNHCLGSHEHIQNCRKWDTEIRLQLLTYNAMCQNLARTTEDDETPVDLNKHLYQIEKP
YREVMTRHPVEELLDSYHNQVELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESV
KKLKRAVNLPRNKTTDVTSLSEGEDTSKSSTRGSLNPENPVQVSMDQLTAAIYDLLRLHA
NSGRSPTDCAPSSRSVKEAWSTTEQLQFTIFAAHGISSNWVSNYEKYYLICSLSHNGKDL
FKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESLLHLTLFGILNQSSGSSPDSNK
QRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVPKKGYVMERIVLQVDF
PSPAFDIIYTTPQVDRSIIQQHNLETLENDVKGKLLDILHKDSSLGLSKEDKAFLWEKRY
YCFKYPNCLPKILASTPNWKWANLAKTYSLLHQWPPLYPLTALELLDSKFADQEVRSLAV
TWIEAISDDELTDLLPQFVQALKYEIYLNSSLVHFLLSRALGNIQIAHNLYWLLKDALHD
VHFSTRYEHVLGALLSVGGKRLRKELLKQAKLVQLLGGAAEKVRQASGSARQVVLQRSME
RVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLKVTMVNADPMGEEINVMFKVG
EDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQVEY
GVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAY
NLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLG
SIATKFNFFIHNLAQLRFSGIPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDK
HYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVA
AKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSADPGPFSPTPGQIG
GAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDIHKTSKRKTKISRKTRN
PTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQL
TAATYL
NT seq 5061 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatatccagcaacagtggagttaaacagtgtccatcttcacatctggaacca
acaagagcaaaagatgtggacaaagaagaagcattacagatggaagcagaggctttagca
aaactgcaaaaggatagacaagttactgacaatcagagaggctttgagttgtcaagtagc
accagacaaaaaacacaggtttataacaaacaggattatgatctcatggtgtttcctgaa
tcagattcccaaaaaagaacattagatattgatgtagaaaagctcactcaagctgaactt
gagaaactattgctggatgacagtttcgagactagaaaaacgcctgtattgccagttact
cctgttctgagcccttctttttcagcacagctctactttagacctactattcagagagga
cagtggccacctggattatctgggccttccacttacgctttaccttctatttatccttct
acttacagtaaacaggctgcattccagaatggcttcaatccaagaatgcccacttttcca
tctacagaacctatatatttaagtcttccgggacaatctccctatttctcatatcctttg
acatctgccacaccctttcatccacaaggaagcttacctatctgtcgtccagtagtcagt
cctgacatggcaaaactatttgacaaaatagctagtacatcagaatttttaaaaaatgga
aaagcaaggactgatttggagataacagattcaaaagtcagcaatctacaggtatctcca
aagtctgaggatatcagtaaatttgactggttagacttggatcctctaagtaagcctaaa
gtggataatgtggaggtattagaccatgaagaagagaaaaatgtttcaagtttgcttgaa
aaggatccttgggatgctgttcttcttgaagagagatccccagcaaattgtcatcttgaa
agaaaggtgaatggaaaatccctttctgtggcaactgtaacaagaagccagtctttaaat
attcgaacatctcagcttgcaaaagtccagagccatatatttcagaaagacccaaatggg
accagtagtttgccaacttcaagttctcttcttcaggaagttgaagtacagaatgaggag
atggcggctttttgtcaatccattacaaaattgaagaccaaatttccatataccaatcac
cgcacaaatccaggctatttgttaagtccagttacactgcaaagaaacatatgtggagaa
aatgctagtgtgaaggtctccattgaaattgaaggatttcagctaccagttacttttacc
tgcgatgtgagttctactgtagaaattattataatgcaagcgctttgctgggtacatgat
gacttgaatcaagtagatgttggcagctatgttctgaaagtttgcggtcaagaggaagtg
ctgcagaataatcattgccttggaagtcatgagcatattcaaaactgtcgaaaatgggac
acagaaattagactacaactcttgacctacaatgcaatgtgtcaaaatctggcccgaaca
acagaagatgatgaaacacctgtggatttaaacaagcacctgtatcaaatagaaaaacct
tacagagaagtcatgacaagacaccctgttgaagaactcttagattcttatcacaaccaa
gtggaactagctcttcaaattgaaaaccagcaccgagcagtagatcaagtaattaaagct
gtaagaaaaatctgtagtgctttagatggtgttgagacccttgccattacagaatcagtt
aagaagctaaagagggcagttaatcttcccaggaataaaactactgatgtgacttctttg
tctgaaggagaagacactagcaagagttcaactaggggctcactgaatcctgaaaatcct
gttcaagtaagcatggaccaattaactgcagcaatttatgaccttctcagactccatgca
aattctggtaggagtcctacagactgtgctccaagtagcaggagtgtcaaggaagcatgg
tctacaacagaacagctacagtttactatttttgctgctcatggaatttcaagtaattgg
gtatcaaattatgaaaaatactacttgatatgttcgctgtctcacaatggaaaggatctt
tttaaacctattcagtcaaagaaggttggcacttacaagaatttcttctatcttattaaa
tgggatgaactaatcatttttcccatccagatatcacaattgccattagaatcacttctt
caccttactctttttggaattttaaatcagagcagtggaagttcccctgattctaataag
cagagaaaggggccagaagctttgggcaaagtttctttacctctttttgactttaaacgg
tttttaacatgtggaactaaacttctgtatctttggacttcatcacatacaaattctgtt
cctggaacagttcccaaaaaaggatatgtcatggaaagaatagtgctacaggttgatttt
ccttctcctgcatttgatattatttatacaactcctcaagttgacagaagcattatacag
caacataacttagaaacactggagaatgatgtaaaagggaaacttcttgatattcttcat
aaagactcatcacttggactttctaaagaagataaagcttttttatgggagaaacgttat
tattgcttcaaataccccaattgtcttcctaaaatattagcgagtaccccaaactggaag
tgggctaatcttgccaaaacttactcattgcttcaccagtggcctccattgtacccatta
acagcattggaacttcttgattcaaaatttgctgatcaggaagtaagatctctagccgtg
acctggattgaggctattagtgatgatgagctaacagatcttcttccacagtttgtacaa
gctttgaaatatgaaatttacttgaatagttcattagtgcacttccttctgtccagggca
ttgggaaatatccagatagcacacaatttatattggcttctcaaagatgccctgcatgat
gtacactttagtacccgatacgaacacgttttgggtgctctcctctcagtaggaggaaaa
cgacttagaaaagaacttctaaagcaggcgaagcttgtacagctgttaggaggagcagca
gaaaaagtaaggcaggctagtggatcagccagacaggttgttctccaaagaagtatggaa
cgagtacagtccttttttcagaaaaataaatgccgtctccctctcaagccaagtctagtg
gcaaaagaattaaatattaagtcctgttccttcttcagttccaatgctgtccccctaaaa
gtcacaatggtgaatgctgaccctatgggagaagaaattaatgtcatgtttaaggttggt
gaagatcttcggcaagatatgttagctttacagatgataaagattatggataagatctgg
cttaaagaaggactagatctgaggatggtaattttcaaatgtctctcaactggcagagat
cgaggcatggtggagctggttcccgcttccgataccctcaggaaaatccaagtggaatat
ggtgtgacaggatcatttaaagataaaccacttgcagagtggctaagaaaatacaatccc
tctgaagaagaatatgaaaaggcttcagagaactttatctattcctgtgctggatgctgt
gtagccacctatgttttaggcatctgtgatcggcacaatgacaatataatgcttcgaagc
acaggacatatgtttcacattgactttggaaagtttttgggacatgcacagatgtttggc
agcttcaaaagggatcgggctccttttgtgctgacttctgatatggcatatgtcattaat
gggggtgaaaagcccaccattcgttttcagttgtttgtggacctctgctgtcaggcctac
aacttgataagaaagcagacaaacctttttcttaacctcctttcactgatgattccttca
gggttaccagaacttacaagtattcaagatttgaaatatgttagagatgcacttcaaccc
caaactacagatgcagaagctacaattttctttactaggcttattgaatcaagtttggga
agcattgccacgaagtttaacttcttcattcacaaccttgctcagcttcgtttttctggt
attccttctaatgatgagcccatcctttcattttcacctaaaacatactcctttagacaa
gatggtcgaatcaaggaagtctctgttttcacatatcataagaaatacaacccagataaa
cattatatttatgtagtccgaattttgagggaaggacagattgaaccatctttcgtcttc
cgaacatttgacgaatttcaggaacttcacaataagctcagtattatttttccactttgg
aagttaccaggctttcctaataggatggttctaggaagaacacacataaaagatgtagca
gccaaaaggaaaattgagttaaacagttatttacagagtttgatgaatgcttcaaccgat
gtagcagagtgtgatcttgtttgtactttcttccaccctttacttcgtgatgagaaagct
gaaggaatagctaggtctgcagatccaggtcccttcagtcctactccaggccaaatagga
ggagctgtgaaattatccatctcttaccgaaatggtactcttttcatcatggtgatgcac
atcaaagatcttgttactgaagatggggctgacccaaatccatatgtcaaaacgtaccta
cttccagatatccacaaaacatccaaacgtaaaaccaaaatttcacgaaaaacgagaaat
ccgacattcaatgaaatgcttgtgtacagtgggtatagcaaagaaaccctaagacagcga
gaacttcaactaagtgtgctgagtgcagaatctctgcgggagaattttttcttgggtgga
gtaactctgcctttgaaagatttcaacttgagcaaagagacagttaaatggtatcagctg
actgcagcaacatacttgtaa

DBGET integrated database retrieval system