KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399819Help
Entry
100399819         CDS       T03264                                 

Gene name
NT5C1A
Definition
(RefSeq) 5'-nucleotidase, cytosolic IA
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc00240  Pyrimidine metabolism
cjc00760  Nicotinate and nicotinamide metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100399819 (NT5C1A)
   00240 Pyrimidine metabolism
    100399819 (NT5C1A)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100399819 (NT5C1A)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     100399819 (NT5C1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-GeneID: 100399819
NCBI-ProteinID: XP_002750688
Ensembl: ENSCJAG00000002566
UniProt: F6WRI5
Position
7
AA seq 365 aa AA seqDB search
MEPGEPQEPREPGPGAETAAAPLWEDAKTFYDSLAPKKKPKSPKPQNAVTIAVSSRALFR
MDEEQRIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPESEDVFDI
VLVTNNHAQVGVRLINSINHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAI
DEGIAAATIFSPSRDVAVSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFFEHEKAHENK
PLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLVTARSAASSGARALKTLRSWGLET
DEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAPAKQ
APSAQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaacctggggaaccccaggagccccgcgagcccgggccaggagcggagaccgctgcg
gccccgctctgggaggacgccaagactttctacgacagcctcgcacccaagaagaaaccc
aaatcgcccaagcctcagaatgcagtcaccatcgctgtgtcctccagagccttatttcgc
atggacgaggagcagcggatctacacggagcagggcgtagaggagtatgtgcgctaccag
ctggaacatgagaacgagcccttcagccccgggcctgccttcccttttgtgaaggctctg
gaggccgtgaacaggcggctgcgggagctgtaccccgagagtgaggacgtcttcgacatc
gtcctcgtgaccaacaaccacgctcaagtgggtgtccgcctcatcaacagtatcaaccac
tatgacctgttcatcgagaggttctgcatgacgggtgggaacagccccatctgctacctc
aaggcctatcacaccaatctctacttgtcagccgatgcagaaaaagtgcgagaagccatt
gatgaggggatcgcagctgccaccatcttcagccccagcagggacgtggctgtgtcccag
agtcaactgcgcgtggccttcgatggggacgctgtgctcttctcggatgagtcggagcgc
attgtcaaggcccacgggctggaccgattcttcgagcatgagaaggcccacgagaacaaa
cctctggctcagggccccttaaagggctttctggaggcactgggtaggttgcagaagaag
ttctactccaaaggcctgaggctggagtgcccaattcgtacctacttggtgacagcacgc
agtgcagccagttctggggcccgggcactcaagaccctgcgcagctggggcctggagaca
gatgaagccttgttcctcgctggagcacccaagggccccctcctcgagaagatccgccca
cacatcttctttgatgaccagatgttccatgtggctggggctcaggagatgggcaccgtg
gctgctcatgtgccttacggcgtggcacagacaccccggcggactgcacctgcaaagcag
gccccatctgcacagtag

DBGET integrated database retrieval system