KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399941Help
Entry
100399941         CDS       T03264                                 

Gene name
VDR
Definition
(RefSeq) vitamin D (1,25- dihydroxyvitamin D3) receptor
  KO
K08539  vitamin D3 receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04978  Mineral absorption
cjc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100399941 (VDR)
  09154 Digestive system
   04978 Mineral absorption
    100399941 (VDR)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100399941 (VDR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100399941 (VDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100399941 (VDR)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100399941 (VDR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cjc03310]
    100399941 (VDR)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100399941 (VDR)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100399941 (VDR)
Nuclear receptors [BR:cjc03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   100399941 (VDR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 100399941
NCBI-ProteinID: XP_002752135
Ensembl: ENSCJAG00000015018
Position
9
AA seq 427 aa AA seqDB search
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPIRVNDVGGSYPSRLNSRHTPSYSG
DSSSCCSDHCITSPDMMESSSFSNLDLSEEDSDDGSVTVDLSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTTDDMSWTCGKQDYKYRVSDV
TKAGYNLELIEPLLKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDATLIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGSEIS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaatggcagccagcacttccctgcctgaccctggagactttgaccggaacgtg
ccccggatctgtggcgtgtgtggagaccgagccacgggcttccacttcaacgctatgacc
tgtgaaggctgcaaaggcttcttcaggcgaagcatgaaacggaaggcactgttcacctgc
cccttcaacggggactgccgcatcacgaaggacaaccggcgccactgccaggcctgccgg
ctcaaacgctgcgtggacatcggcatgatgaaggagtttatcctgacagatgaggaggtg
cagaggaagcgggagatgatcctgaaacggaaggaggaggaggccttgaaggacagtctg
cggcccaagctgtccgaggagcagcagcgcatcattgccatcctgctggatgcccaccat
aagacctatgaccccacctactctgacttctgccagttccggcctccgattcgtgtgaat
gatgttggagggagctatccttccaggctcaactcgagacacactcctagctactccggg
gactcctcctcctgctgctcagatcactgtatcacctctccagacatgatggaatcatcc
agcttctccaacctggatctgagtgaagaagattcagatgatggttctgtgaccgtggac
ctgtcccagctatccatgctgccccatctggctgacctggtcagttacagtatccaaaag
gtcattggctttgctaagatgatcccaggattcagagacctcacctctgaggaccagatc
gtgctgctgaagtccagtgccatcgaggtcatcatgttgcgctccaatgagtccttcacc
acagacgacatgtcctggacctgcggcaaacaagactacaagtatcgcgtcagtgatgtg
accaaagcaggatacaacctggagctgattgagcccctcctcaagttccaggtagggctg
aagaagctgaacttgcatgaggaggagcatgtcctgctcatggccatctgcatcgtttcc
ccagatcgtcccggggtgcaggacgccacgctgattgaggccatccaggaccgcctgtcc
aacacgctacagacctacatccgctgccgccacccgcccccaggcagccacctgctctat
gccaagatgatccagaagctggccgacctgcgcagcctcaacgaggagcactccaagcag
taccgctgcctctccttccagcccgagtgcagcatgaagctcacgccccttgtgctggag
gtgttcggcagtgagatctcctga

DBGET integrated database retrieval system