KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400096Help
Entry
100400096         CDS       T03264                                 

Gene name
SUCLA2
Definition
(RefSeq) succinate-CoA ligase ADP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00020  Citrate cycle (TCA cycle)
cjc00640  Propanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
Module
cjc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100400096 (SUCLA2)
   00640 Propanoate metabolism
    100400096 (SUCLA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100400096 (SUCLA2)
Enzymes [BR:cjc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100400096 (SUCLA2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100400096 (SUCLA2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100400096 (SUCLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 100400096
NCBI-ProteinID: XP_002742721
Ensembl: ENSCJAG00000009278
Position
1
AA seq 463 aa AA seqDB search
MAASVFYGRLLAAVTLRNHRPRSALRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMS
MELLQEAGVSIPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVK
IVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGP
VLIGSSHGGVNIEDVAAETPEAIIKEPIDIVEGIKKEQALRLAQKMGFPPNIVDSAAENM
VKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDER
DKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVTEA
FKLITSDKKVLAILVNIFGGIMRCDVIAQGIVMAVKDLEIRIPVVVRLQGTRVDDAKALR
ADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLPI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgtattctacggccggttgttggctgccgtcacccttcggaaccaccgg
cctcggtcggccctgcgggccgctgctcaggttctgggaagttctggattgtttaataac
catggacttcaagtacagcagcaacagcaaaggaatctctcactgcatgaatacatgagt
atggaattattgcaagaagctggtgtctccattcccaaaggatatgtggcaaagtcacca
gatgaagcttacgcaattgccaaaaaattaggttcaaaagatgttgtgataaaggcacag
gttttagctggtggtagaggaaaaggaacatttgaaagtggcctcaaaggaggagtgaag
atagttttctctccagaagaagcaaaagctgtttcttcacaaatgattgggaaaaagttg
tttaccaagcaaacgggagaaaagggcagaatatgcaatcaagtattggtctgtgagcga
aaatatcccaggagggagtactactttgcaataacaatggaaaggtcatttcaaggtcct
gtattaataggaagttcacatggtggtgtcaacattgaagatgttgctgctgagactcct
gaagcaataattaaagaacctattgatattgtggaaggcatcaaaaaggaacaagctctc
cggcttgcacagaagatggggtttccacctaatattgtggattcagcagcagaaaacatg
gtcaagctttacagcctttttctgaaatacgatgcaaccatgatagaaataaatccaatg
gtggaagattcagatggagctgtattgtgtatggatgcaaagatcaattttgactctaat
tcagcctatcgccaaaagaaaatctttgatctacaagactggacccaggaagatgaaaga
gacaaagatgctgctaaggcaaatctcaactacattggccttgatggaaatataggctgc
ctagtaaatggtgctggtttggctatggccacaatggatataataaaacttcatggaggg
actccagccaacttccttgatgttggtggtggtgctacagtccatcaagtaacagaagcg
tttaagcttatcacttcagataaaaaggtactggctattctggtcaacatttttggagga
attatgcgctgtgatgttattgcacagggtatagtcatggcagtaaaagatttggaaatt
agaatccctgttgtggtacggttacaaggtacacgagtcgatgatgctaaggcactgaga
gcagacagtggacttaaaatacttgcttgtgatgacttggatgaagctgctagaatggta
gtaaaactctctgaaatagtgaccttagcaaagcaagcacatgtggatgtgaaatttcag
ttgccaatatga

DBGET integrated database retrieval system