KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400130Help
Entry
100400130         CDS       T03264                                 

Gene name
MLKL
Definition
(RefSeq) mixed lineage kinase domain like pseudokinase
  KO
K08849  mixed lineage kinase domain-like [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100400130 (MLKL)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100400130 (MLKL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100400130 (MLKL)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100400130 (MLKL)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: TKL group
  Other
   100400130 (MLKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SlyX
Motif
Other DBs
NCBI-GeneID: 100400130
NCBI-ProteinID: XP_017822508
Position
20
AA seq 256 aa AA seqDB search
MGKSVLELCLRGGEGLENLRDIITLGQVIYKQYEEMKYCKKQCQRLGSRVLGLAESLEML
QDQGKRRVTSEKLTTAMNRFKAALXEADGEIEKFSNKSSIWRFLTASQDKIIFDDINNNL
NDVWKELLLLLQVEQYLSVLHISQGASWAQEDQQDAAEDRQAFQMLRRDNENIDALLRLL
EIDMKEIKETLRQYLPPKRMQEIPQEQVKEIKKEQLSGSPWILLSKNKVSTLYKGEYRRA
RVAIKVFHKPQADSIG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagagcgttttggaactgtgcctccgaggaggtgaaggtctggaaaatttgagg
gatatcatcaccttaggccaggtcatctacaaacagtatgaagagatgaaatactgcaag
aaacagtgccagcgcctgggcagccgtgtcctaggcctggccgagtctctggagatgctc
caggaccaaggaaagaggagggtgacctctgagaagttaaccacagccatgaaccgcttc
aaggctgccctannggaggctgatggggagatagaaaagttcagcaataaatccagcatt
tggaggtttctaacagcaagccaggacaaaataatcttcgacgacatcaacaataacctg
aatgatgtctggaaggagctattgctgttacttcaggttgagcaatacctgtctgtttta
cacataagccaaggagcgtcctgggcacaggaagatcagcaggatgcagctgaagacaga
caagccttccagatgctgagaagggataatgaaaacatagacgctttattgagactattg
gaaatcgacatgaaagaaatcaaggaaactttgaggcagtatttaccaccaaaacgcatg
caggagatccctcaggagcaagtcaaggagatcaagaaggagcagctttcaggatccccg
tggattctgctaagcaaaaataaggtcagcacactttataaaggagaataccgcagagct
cgagtagccatcaaagtattccacaaacctcaggctgacagcattgggtaa

DBGET integrated database retrieval system