KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400179Help
Entry
100400179         CDS       T03264                                 

Gene name
NMNAT1
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00760  Nicotinate and nicotinamide metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100400179 (NMNAT1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     100400179 (NMNAT1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     100400179 (NMNAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like DPPIV_rep ChapFlgA
Motif
Other DBs
NCBI-GeneID: 100400179
NCBI-ProteinID: XP_002750316
Ensembl: ENSCJAG00000005483
UniProt: U3CM79
Position
7
AA seq 280 aa AA seqDB search
MENSEETEVVLLACGSFNPITNMHLRLFELAKDYLNGTGRYRVVKGIISPVGDAYKKKGL
IPAHHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASNCDHQQNSPTL
ERPGRKRKWTEQKQDSNQKKSLDPKTKAAPKVKLLCGADLLESFAVPNLWKSEDIAQIVA
DYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWITNDISSTKIRRALRRGQSIRYL
VPDLVQEYIENHNLYSSESEDRNAGVILAPLQRNTAEAKT
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattctgaagagactgaagtggttctccttgcttgtggttccttcaatcccatc
accaacatgcacctcaggttgtttgagctggccaaggactacttgaatggaacaggcaga
tacagagttgtcaaaggcatcatctctcctgttggtgacgcctataagaagaaaggactc
attcctgcccatcaccgggtcatcatggcagaacttgccaccaagaattccaaatgggtg
gaagttgatacatgggaaagtcttcagaaggagtggaaagagactcttaaggtcctaaga
caccatcaagagaaactggaggctagtaactgtgatcaccagcagaattcacctacgcta
gaaaggcctggacggaagaggaagtggactgagcaaaaacaagattctaatcaaaagaaa
tccctagatccgaaaacaaaagctgcacccaaggtcaagctgctgtgtggggcagattta
ctggagtcctttgctgttcccaatttgtggaagagtgaagacatcgcccaaatcgtggct
gactatgggctcatatgtgtcactcgggctggaaatgatgctcagaaatttatctatgaa
tcagatgtgctgtggaaacaccggagcaacattcacgtggtgaatgaatggatcactaat
gacatctcatcaacaaaaatccggagagccctcagaaggggccagagcattcgctacttg
gtaccagatcttgtccaagaatacattgaaaatcataatttgtacagctctgagagtgaa
gacaggaatgctggggtcatcctggcccctttgcagagaaacactgcagaagctaagaca
taa

DBGET integrated database retrieval system