KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400417
Entry
100400417         CDS       T03264                                 

Symbol
INHBA
Name
(RefSeq) inhibin beta A subunit
  KO
K04667  inhibin beta A chain
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04350  TGF-beta signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100400417 (INHBA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100400417 (INHBA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100400417 (INHBA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100400417 (INHBA)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100400417 (INHBA)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100400417
NCBI-ProteinID: XP_002751400
Ensembl: ENSCJAG00000007682
Position
8
AA seq 426 aa
MPLLWLRGFLLASCWIIVRSSPTPGSEGHGAAPDCPSCALAALPKDVPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGILDTGEETEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGANLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWSDWIIAPSGYHANYCEGECPSHIAG
TSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
EECGCS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcccttgctttggctgagaggatttctgttggcaagttgctggattatagtgaggagt
tcccccaccccaggatccgaggggcacggcgcggcccccgactgtccgtcctgtgcgctg
gccgccctcccaaaggatgtacccaactctcagccagagatggtggaagccgtcaagaag
cacattttaaacatgctgcacttgaagaagagacccgatgtcacccagccggtgcccaag
gcggcgcttctgaacgcgatcagaaagcttcacgtaggcaaagtcggggagaacgggtat
gtggagatagaggatgacattggaaggagggcagaaatgaatgaacttatggagcagacc
tcggagatcatcacgtttgccgagtcaggcacagccaggaagacgctgcacttcgagatt
tccaaggaaggcagtgacctgtcagtggtggagcgtgcagaagtctggctcttcctgaaa
gtccccaaggccaacagaaccaggaccaaagtcaccatccgtctcttccagcagcagaag
cacccacagggcatcttggacacaggggaggagaccgaggaagtgggcttaaagggggag
aggagtgaactgttgctctctgaaaaagtggtagacgctcggaagagcacctggcacgtc
ttccctgtctccagtagcatccagcggttgttggaccagggcaagagctccctggacgtt
cggattgcctgcgagcagtgccaggagagtggcgccaacctggtgctcctgggcaagaag
aagaagaaagaagaggagggggaagggaaaaagaagggtggaggtgaaggtggggcagga
gcagatgaggagaaggagcagtcgcacagacctttcctcatgctgcaggcccggcagtct
gaagaccaccctcatcgccggcgtcggcggggcttagagtgtgacggcaaggtcaacatc
tgctgtaagaaacagttctttgtcagtttcaaggacatcggctggagtgactggatcatt
gctccctctggctatcatgccaactactgcgagggtgagtgcccgagccatatagcaggc
acatccgggtcctcgctgtccttccactcgacagtcatcaaccactaccgcatgcggggc
cacagcccctttgccaacctcaaatcgtgctgtgtgcccaccaagctgagacccatgtcc
atgttgtactatgatgatggtcaaaacatcatcaaaaaggacattcagaacatgatcgtg
gaggagtgcgggtgctcgtag

DBGET integrated database retrieval system