KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400510Help
Entry
100400510         CDS       T03264                                 

Gene name
EDA2R
Definition
(RefSeq) ectodysplasin A2 receptor
  KO
K05163  tumor necrosis factor receptor superfamily member 27
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100400510 (EDA2R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100400510 (EDA2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100400510 (EDA2R)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100400510 (EDA2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Motif
Other DBs
NCBI-GeneID: 100400510
NCBI-ProteinID: XP_003735798
Ensembl: ENSCJAG00000003590
UniProt: F7EQV1
Position
X
AA seq 297 aa AA seqDB search
MDCQENEYLDQWGRCVTCQQCGPGQELSKDCGYGEGGDAYCTACPPHRYKSSWGHHRCQT
CITCAVINRVQKFNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAF
QLSLVEADEPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGSLQFEA
DKAAEEESLFPMPPSKETSPESQVSESIFQTQPLNPILEDDCSSTGGFPTQESFTMASCA
SESHSHWVHNPIECTELDLQKFSSSASYTGAETLGGNTAESTGDRLELNVPFEVPSP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggattgccaagaaaatgaatacttggaccaatggggacggtgtgtcacctgccagcag
tgtggtcctggacaggagctatccaaggattgtggttatggagagggtggagatgcatac
tgcacagcctgccctcctcacaggtacaaaagcagctggggccaccacagatgtcaaact
tgcattacctgtgctgtcatcaatcgtgttcagaagttcaactgcacagctacctctaat
gctgtctgtggagactgtctgcccaggttctaccgaaagacacgcattggaggcctgcag
gaccaagagtgcatcccgtgcacgaagcagacccccacctctgaggttcaatgtgccttt
cagttgagcttagtggaggcagatgaacccacagtgccccctcaggaggccacacttgtt
gcactggtgagcagcctgctggtggtatttaccctggccttcctggggctcttcttcctc
tactgcaagcagttcttcaacagacattgccagcgtggaggttcgctgcaatttgaggct
gataaggcagcagaggaagaatctctcttccccatgccacccagcaaggagaccagtcct
gagtcccaagtgagtgagagcatctttcagacgcagccacttaaccctatcctcgaggac
gactgcagctcgactggtggctttcccacacaggagtcctttaccatggcctcctgcgcc
tcagagagccactcccactgggtccacaaccccatcgaatgcacagagctggacctgcaa
aagttttccagctctgcctcctatactggagctgagaccttggggggaaacacagctgaa
agcacaggagacaggctggagctcaatgtgccctttgaagttcccagcccttaa

DBGET integrated database retrieval system