KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400521Help
Entry
100400521         CDS       T03264                                 

Definition
(RefSeq) apoptotic protease-activating factor 1-like
  KO
K02084  apoptotic protease-activating factor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Module
cjc_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100400521
   04215 Apoptosis - multiple species
    100400521
   04115 p53 signaling pathway
    100400521
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400521
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100400521
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100400521
   05012 Parkinson disease
    100400521
   05014 Amyotrophic lateral sclerosis (ALS)
    100400521
   05016 Huntington disease
    100400521
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100400521
   05152 Tuberculosis
    100400521
  09172 Infectious disease: viral
   05162 Measles
    100400521
   05164 Influenza A
    100400521
   05161 Hepatitis B
    100400521
   05160 Hepatitis C
    100400521
   05168 Herpes simplex virus 1 infection
    100400521
   05169 Epstein-Barr virus infection
    100400521
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100400521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 100400521
NCBI-ProteinID: XP_008988705
Position
9
AA seq 148 aa AA seqDB search
MFSPDGSSFLTSSDDQTIRLWETKKVCKNSPIMFKQEVDVVFQENEVMVLAVDHRKHHLQ
LINGKTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILEPVNNRIFQSRIRHKKTVR
HIQFTADEKTLISSSDDSAIQVRGRMNS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcctgatggatcatcatttttgacatcttctgatgaccagacaatcaggctc
tgggagacaaagaaagtatgtaagaactctcctataatgttcaagcaagaagtagatgtt
gtgtttcaagaaaatgaagtgatggtccttgcagttgaccatagaaaacatcatctgcaa
ctcattaatggaaaaacaggtcagattgattatctgactgaagctcaagttagctgctgt
tgcttaagtccacatcttcagtacatagcatttggagacgaaaatggagccattgagatt
ttagaacctgtaaacaatagaatcttccagtccaggattcggcacaagaaaactgtacgg
cacatccagttcacagccgatgagaagactcttatttcaagttctgatgattctgcaatt
caggtgagagggaggatgaactcttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403825Help
Entry
100403825         CDS       T03264                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Module
cjc_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100403825 (APAF1)
   04215 Apoptosis - multiple species
    100403825 (APAF1)
   04115 p53 signaling pathway
    100403825 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403825 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100403825 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100403825 (APAF1)
   05012 Parkinson disease
    100403825 (APAF1)
   05014 Amyotrophic lateral sclerosis (ALS)
    100403825 (APAF1)
   05016 Huntington disease
    100403825 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100403825 (APAF1)
   05152 Tuberculosis
    100403825 (APAF1)
  09172 Infectious disease: viral
   05162 Measles
    100403825 (APAF1)
   05164 Influenza A
    100403825 (APAF1)
   05161 Hepatitis B
    100403825 (APAF1)
   05160 Hepatitis C
    100403825 (APAF1)
   05168 Herpes simplex virus 1 infection
    100403825 (APAF1)
   05169 Epstein-Barr virus infection
    100403825 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100403825 (APAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 AAA_16 Utp8 Hira ATPase_2 DUF4441 NACHT AAA_18
Motif
Other DBs
NCBI-GeneID: 100403825
NCBI-ProteinID: XP_009002665
Ensembl: ENSCJAG00000002341
Position
9
AA seq 1249 aa AA seqDB search
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTILEEEKVRNEPTQQQRAAMLIKMI
LKKDNGSYISFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVTGITSYVRTVLCEGGVP
QRPVVFVARNKLVNAIHQKLSKLNGDPEWVTIYGMAGCGKSVLAAEAVRDHSLLKHCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPSCLL
ILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVIPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLRENIKNYYTDLSILPKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNRSQLQDLHKKMITQFQKYYQLPNLLPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGTLYLEWINK
KTIMNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHNYDEHSEQVNCCHFTNSSHHFLLATGS
SDCVLKLWDLNQKQCRNTLFGHINSVSHCRFSPDDKLLASCSADGTLKLWDVTSANERKS
INVKQFFLNSEDLQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIYTSDLLGEILMGHH
STIQYCDFSPQNHLAVVALSQYCVELWNIDSCSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSPIMFKQEVDVVFQENEVMVLAVDHRKHHLQLINGKTGQIDYL
TEAQVSCCCLSPHLQYIAFGDENGAIEILEPVNNRIFQSRIRHKKTVRHIQFTADEKTLI
SSSDDSAIQVWNWQLEKCEVLQAHQEPVKDFRLLKNSRLLSWSFDGTVKVWNIFTGKVEK
DFVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLSPLHELRGHNGCVRCSAFSVDS
TLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYL
KWWNVVTGQSLQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagctctggaaaaggatatc
aagacatcctacatcatggatcacatgattagtgatggatttttaacaatattagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctaattaaaatgata
cttaaaaaagataatggttcctacatatcattctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtggtaaa
gattcagttactggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtacca
cagagaccagttgtttttgtcgcaaggaataaactggtgaatgcaattcaccagaagctc
tcgaaattgaatggtgacccagaatgggtcaccatatatggaatggcaggctgtgggaag
tctgtattagctgcagaagctgttagagatcattccctcttaaaacattgtttcccaggg
ggagtgcattgggtttcagttgggaaacaagataaatctgggcttctgatgaaactgcag
aatctttgcacacgattggatcaggatgagagtttttcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgcattctgatgcttcgcaaacacccaagctgtctgttg
atcttggacgatatttgggacccttgggtattgaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagacaagagtgtaacagattcagtaatgggtcctaaatatgtaatc
cctgtggagagtagcttaggaaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
ccccttgtagtatctttaattggtgcacttttacgtgattttcccaatcgctgggagtac
tacctcagacaacttcagaataaacagttcaagagaataaggaaatcttcatcttatgat
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaaaacatcaaa
aattattacacagatctttccatccttcccaaggatgttaaggtgcctacaaaggtgtta
tgcattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtaaat
aagtctcttttattctgtgatcggaatggaaagtcgtttcgttattatttacacgatctt
caagtagattttcttacagaaaagaatcgcagccagcttcaggatctacataagaagatg
atcactcagtttcagaaatattaccagctgccaaatcttttaccagatcaggaagactgt
atgtattggtacaactttctggcctaccacatggccagtgccaagatgcacaaggaactt
tgtgctttaatgttttccctggattggattaaagcaaaaacagaacttgtaggccctgct
catctgattcatgaatttgtggaatacagacatatactagatgaaaaggattgtgcggtc
agtgagaattttcaggagtttttatctttaaatggacaccttcttggacgacagccattt
cctaatattgtacaactgggtctctgtgagccagaaacttcagaagtttatcagcaagct
aagctgcaggccaagcaggaggtcgataatggaacgctttacctggaatggataaacaaa
aaaaccatcatgaatctttcccgcttagttgtccgcccccacacagatgctgtttaccat
gcttgcttttctgaggatggtcagagaatagcttcttgtggagctgataaaaccttacag
gtgttcaaagctgaaacaggagagaaacttctagaaatcaaggctcatgaagatgaagtg
ctttgttgtgcattctctacagatgacagatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaattctatgaccggggaactagtacataactatgatgagcactcagag
caagtcaattgctgccatttcaccaacagtagtcatcattttctcttagccactgggtca
agtgactgcgtcctgaaactctgggatttgaatcaaaaacaatgtcgaaataccctgttt
ggccatataaattcagtcagtcactgcagattttcaccagatgataagcttttggctagt
tgctcagccgatggaaccttaaagctttgggatgtgacatcagcaaatgagaggaaaagc
attaatgtgaaacagttcttcctaaattcagaggaccttcaagaggatatggaagtgata
gtgaagtgttgttcatggtctgctgatggtgcaaggataatggtggcagcgaaaaataaa
atcttcctttttgacatttataccagtgacctattgggagaaatcctcatgggccatcac
agcaccatccagtactgtgacttctccccccaaaaccatttggcagtggtggctttgtcc
cagtactgtgtagagttgtggaatatagactcatgttcaaaggtggctgactgcagagga
catttaagttgggttcatggtgtgatgttttctcctgatggatcatcatttttgacatct
tctgatgaccagacaatcaggctctgggagacaaagaaagtatgtaagaactctcctata
atgttcaagcaagaagtagatgttgtgtttcaagaaaatgaagtgatggtccttgcagtt
gaccatagaaaacatcatctgcaactcattaatggaaaaacaggtcagattgattatctg
actgaagctcaagttagctgctgttgcttaagtccacatcttcagtacatagcatttgga
gacgaaaatggagccattgagattttagaacctgtaaacaatagaatcttccagtccagg
attcggcacaagaaaactgtacggcacatccagttcacagccgatgagaagactcttatt
tcaagttctgatgattctgcaattcaggtatggaattggcaactggagaaatgtgaagtt
ctacaagcccatcaggaaccagtgaaagacttcagactcttgaaaaattcaagactgctt
tcttggtcatttgatggaacagtgaaggtatggaatatttttactggaaaagtagaaaaa
gactttgtctgtcaccagggtacagtactttcttgtgacatttctcatgatgctaccaag
ttttcatctacctctgctgacaagactgcaaagatctggagttttgatctcctttcgcca
cttcatgaattgaggggccataatggttgtgtgcgctgctctgccttctctgtggacagt
accttgctggcaacgggagatgacaatggagaaatcaggatatggaatgtctcaaacggt
gagctgcttcatttgtgtgctccgctttcagaagaaggagctgctacccatggaggctgg
gtgactgacctttgcttttctccagatggcaaaatgcttatctctgctggaggatatctt
aagtggtggaacgttgtcactgggcaatccttacagaccttctacacaaatggaaccaat
cttaagaaaatacatgtgtcccctgacttcaaaacatatgtgactgtggataatcttggt
attttatatattttacagactttagaataa

DBGET integrated database retrieval system