KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400724
Entry
100400724         CDS       T03264                                 
Symbol
PCDH10
Name
(RefSeq) protocadherin 10
  KO
K16499  protocadherin delta 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100400724 (PCDH10)
Cell adhesion molecules [BR:cjc04515]
 Cadherins
  Protocadherins
   100400724 (PCDH10)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2
Other DBs
NCBI-GeneID: 100400724
NCBI-ProteinID: XP_017825732
UniProt: F7IEG7
Position
3:complement(60084101..60145632)
AA seq 1058 aa
MIVLLFFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSR
TPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPP
SFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRF
AELVLEKPLDREQQAVHRYVLTAVDGGGGGGGGGEGGGGGGGAGLPPQQQRTGTALLTIR
VLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARE
LFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEIS
FSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEA
PLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPG
AYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDF
SFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYL
LTRVAAVDADDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIE
VRDHGQPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQRPSRSGGGETSLDLTLILI
IALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCCGGGGSTCCGRQARARK
KKLSKSDIMLVQSSNVPSNPAQVPVEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKP
CSPSRSTDTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQRAELSYLVDRPRRVNSSA
FQEADIVSSKDSGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHSDRCWMPSFV
PSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELD
GLLSNTRAPYKPPYLKLLWRQLRGETNVAQDQGLPPTT
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgattgtgctattattctttgccttgctctggatggtggaaggagtcttttcccagctt
cactacacggtacaggaggagcaggaacatggcactttcgtggggaatatcgctgaagat
ttgggtctggacattacaaaactttcggctcgcgggtttcagacggtgcccaactcaagg
accccttacttagacctcaacctggagactggggtgctgtacgtgaacgagaaaatagac
cgcgagcaaatctgcaaacagagcccctcctgtgtcctgcacctggaggtctttctggag
aaccccctggagctgttccaggtggagatcgaagtgctggacattaatgacaacccccct
tctttcccggagccggacctgacggtggaaatctctgagagcgccacgccaggcactcgc
ttccccttggagagcgcattcgacccagacgtgggcaccaactccttgcgcgactacgag
atcacccccaacagctacttctccctggacgtgcagacccagggggatggcaaccgattc
gctgagctggtgctggagaagccactggaccgagagcagcaagcggtgcaccgctacgtg
ctgaccgcggtggacgggggaggagggggaggaggaggaggagaaggagggggaggtggc
gggggagcgggcctgccaccccagcagcagcgcaccggcacggccctactcaccatccga
gtgctggactccaacgacaatgtgcccgctttcgaccaacccgtctacactgtgtcccta
ccagagaactcgcccccaggcactctcgtgatccagctcaatgccacggacccggacgag
ggccagaacggtgaggtcgtgtactccttcagcagccacatttcgccccgggcacgggag
cttttcggactctcgccgcgcactggccgactggaggtaagcggcgagttggactatgaa
gagagcccggtgtaccaagtgtacgtgcaagccaaggacttgggccccaacgccgtgcct
gcgcactgcaaggtgctagtgcgagtactggatgctaacgacaacgcgccagaaatcagc
ttcagcacggtgaaggaggcggtgagcgagggcgcggcgcccggcactgtggtggccctt
ttcagcgtgaccgaccgcgactcagaggagaacgggcaggtgcagtgcgagctgctggga
gatgttccgttccgcctcaagtcttcctttaagaattactacaccatcgttaccgaagcc
cccctggaccgagaggcgggggactcctacaccttgaccgtggtggcccgggaccgaggc
gagcctgcgctctccaccagtaagtcgatccaggtgcaagtgtcggatgtgaacgacaac
gcgccgcgcttcagccagccggtctacgacgtgtatgtgactgagaacaacgtgcctgga
gcctacatctacgcggtgagcgccaccgaccgcgatgagggcgccaacgcccagcttgcc
tactctatcctcgagtgccagatccagggcatgagcgtcttcacctacgtgtccatcaac
tctgagaacggctacttgtacgccctgcgctccttcgactacgagcagctcaaggacttc
agctttcaggtggaagcccgggacgctggcagtccccaggcgctggcgggaaacgccact
gtcaacatcctcatagtggatcaaaatgacaacgcccctgccatcgtggcgcctctacca
gggcgcaacgggacgccagcgcgtgaggtgctgccccgctcggcagagccgggctacctg
ctcacccgtgtcgccgcggtagacgcggatgacggcgagaacgctcggctcacttacagc
atcgtgcgtggcaacgaaatgaacctctttcgcatggactggcgcaccggggagctgcgc
acagcgcgccgagtcccggccaagcgcgacccccagcggccttatgagctggtgatcgag
gtgcgtgaccatgggcagccgcccctgtcctctaccgccaccctggtggttcagctggtg
gatggtgccgtggagcctcagggcggaggcgggagcggaggcggagggtcaggggagcac
cagcgccccagccgctccggcggcggggaaacctcgctagacctcaccctcatcctgatc
atcgcgctgggctcggtgtccttcatcttcctgctggccatgattgtgctggccgtgcgt
tgccaaaaagagaagaagctcaacatctacacttgtctggccagtgattgctgcctctgc
tgctgctgctgcggtggcggaggttcgacctgctgtggccgccaagcccgggcgcgcaag
aagaaactcagcaagtcggacatcatgctggtgcagagctccaatgtacccagtaacccg
gcgcaggtgcccgtggaggagtccgggggctttggctcccaccaccacaaccagaattac
tgctaccaggtctgcctgacccctgagtcagccaagaccgacctgatgtttcttaagccc
tgcagcccttcgcggagtacggacactgagcacaacccctgcggggccatcgtcacgggt
tataccgaccagcaacccgatatcatctccaacggaagcattttgtccaacgagactaaa
caccagcgagcagagctcagctatctagttgacagacctcgccgagttaacagttctgca
ttccaggaagccgacatagtaagctctaaggacagtggtcatggagacagtgaacaggga
gatagtgatcatgatgccaccaaccgtgcccagtcggctggtatggatctcttctccaac
tgcactgaggaatgtaaagctcttggccactcagatcggtgctggatgccttcttttgtc
ccttctgatggacgccaggctgctgattatcgcagcaatctgcatgttcccggcatggac
tctgttccagacactgaggtgtttgaaactccagaagcccagcctggggcagagcggtcc
ttctccacctttggcaaggagaaggcccttcacagcactctggagaggaaggagctggat
ggactgctgtctaatacgcgagcgccttacaaaccaccatatttgaagctattgtggagg
cagctacgtggagagaccaatgtggcacaagatcaagggctaccaccaaccacatga

DBGET integrated database retrieval system