KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400844Help
Entry
100400844         CDS       T03264                                 

Gene name
CXCL5
Definition
(RefSeq) C-X-C motif chemokine ligand 5
  KO
K05506  C-X-C motif chemokine 5/6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04657  IL-17 signaling pathway
cjc05133  Pertussis
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100400844 (CXCL5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100400844 (CXCL5)
   04062 Chemokine signaling pathway
    100400844 (CXCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100400844 (CXCL5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100400844 (CXCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100400844 (CXCL5)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100400844 (CXCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100400844
NCBI-ProteinID: XP_002745800
Ensembl: ENSCJAG00000013911
Position
3
AA seq 123 aa AA seqDB search
MSLLSSRAASLPGPSGSLCAPLALVLLLLLLLTAPGPSPALRAQAGPVAAVLRELRCICL
HTTQRDPPKMISNLQVFAPGPQCSKVEVIASMKNGEEVCLDPETPFLKKVIQKILDGGNR
KTD
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggccagtctccctggtccttccggctccttgtgcgca
ccgctggcgctggtgctgctgctgctgctgctgctgacagcgccgggcccctcgccagcg
ttgagagcgcaggccggtcctgtcgctgctgtgttgagagagctgcgttgcatttgttta
cacactacgcagcgagatccccccaaaatgatcagtaatctgcaggtgttcgccccaggc
ccgcagtgctccaaggtggaagtgatagcctccatgaagaacggggaggaagtttgtctt
gatccagaaaccccttttctaaagaaagtcatccagaaaattttggacggtggaaacagg
aaaactgattaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403029Help
Entry
100403029         CDS       T03264                                 

Gene name
CXCL6
Definition
(RefSeq) C-X-C motif chemokine ligand 6
  KO
K05506  C-X-C motif chemokine 5/6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04657  IL-17 signaling pathway
cjc05133  Pertussis
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100403029 (CXCL6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100403029 (CXCL6)
   04062 Chemokine signaling pathway
    100403029 (CXCL6)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100403029 (CXCL6)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100403029 (CXCL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100403029 (CXCL6)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100403029 (CXCL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100403029
NCBI-ProteinID: XP_002745804
Ensembl: ENSCJAG00000013938
Position
3
AA seq 116 aa AA seqDB search
MSLLSSRAASLRGPSGSLCAPLALLLLLLTAPGPLASAGPVSVVLKELRCTCLHVMPRVN
AKMISNLQVFPAGPQCSKVEVIASLKDGTQVCLDPEAPFLKKVIQKILGSGNKKNE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggccagtctccggggtccttccggttccttgtgcgcg
ccgctggcgctgctgctgctgctgctgacggcgccggggcccctagccagcgctggtcct
gtctctgttgtgctgaaagagctgcgttgcacttgtttacacgttatgccgagagtaaac
gccaaaatgatcagtaatctgcaggtgttcccagcaggtccacagtgctccaaggtggaa
gtgatagcctccctaaaggacgggacacaagtttgtttggatccggaagccccttttcta
aagaaagtcatccagaaaattttgggcagcggaaacaagaaaaatgagtga

DBGET integrated database retrieval system