KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401171Help
Entry
100401171         CDS       T03264                                 

Gene name
IL21R
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100401171 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100401171 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100401171 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100401171 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100401171 (IL21R)
   04090 CD molecules [BR:cjc04090]
    100401171 (IL21R)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL2 receptor family
   100401171 (IL21R)
CD molecules [BR:cjc04090]
 Proteins
  100401171 (IL21R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4Ra_N Phage_holin_T EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 100401171
NCBI-ProteinID: XP_009007600
Position
12
AA seq 281 aa AA seqDB search
MLLGSAVPLLMLLLQGGWGCPALVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EVTSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFVLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPDFFMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFHKDSSYELQVXAGPMPGSSYQGTXSKWSDPVIFQTQSEELKEGWNPHLLL
LLLFVIVFIPALWGLKTQHGGEAMRKAGRWSGWAAAPLWYT
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttggctcggctgtccccttgctcatgctgctgctccagggaggctggggctgc
cccgccctcgtctgctacacagattacctccagacggtcatctgcatcctggagatgtgg
aacctccaccccagcacactgaccctcacctggcaagaccagtatgaagagctgaaggac
gaggtcacctcctgcagcctccacaggtcggcccacaacgccacgcatgccacgtatacc
tgccacatggatgtgttccacttcatggctgatgacattttcagtgtcaacatcacagat
cagtctggcaactactcccaggagtgtggcagctttgtcctggctgagagcatcaagccg
gctccccctttcaacgtgaccgtgaccttctcaggacagtataatatctcctggcgctcg
gattacgaagaccccgacttcttcatgttgaagggcaagcttcaatatgagctgcagtac
aggaaccggggagacccctgggctgtgagtccaaggagaaagctgatctcagtggactcg
agaagtgtctccctcctccccttggagttccacaaagactcaagctatgagctgcaggtg
tgagcagggcccatgcctggctcctcctaccaggggacctgaagcaagtggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgtttgtcatagtcttcattcctgccctctggggcctgaagacccagcatgga
ggcgaggccatgagaaaggcagggaggtggtcgggctgggctgctgcccctctatggtac
acctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108590123Help
Entry
108590123         CDS       T03264                                 

Definition
(RefSeq) interleukin-21 receptor-like
  KO
K05075  interleukin 21 receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    108590123
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108590123
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108590123
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    108590123
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    108590123
   04090 CD molecules [BR:cjc04090]
    108590123
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL2 receptor family
   108590123
CD molecules [BR:cjc04090]
 Proteins
  108590123
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 108590123
NCBI-ProteinID: XP_017824529
Position
12
AA seq 185 aa AA seqDB search
MAQNSGGLAYSEEGDRPYGLLSIDTVTVLDAEGLCTGPCSCEDDGYPALDLDTGLEPSPG
LEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGRA
LESEAGSPPAGLDMDTFDSGFAGSDCSSPVECDFTSPGDEGPPRSYLRQWVIIPSPLSSP
GPQAS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaactctgggggcttagcttacagcgaggagggggaccggccatacggcctg
ctgtccatcgacacagtgactgtactagatgcagagggactgtgcaccgggccttgcagc
tgtgaggatgacggctacccagccctggatctggacaccggccttgagcccagcccaggc
ctagaggacccactcttggatgcgggcaccacagtcctctcctgtggctgtgtctcggct
ggcagtcctgggctaggagggcccctgggaagcctcctggacagactaaagccacccctt
gcagatggggaggactgggctgggggactgccctggggtggccggtcacccggacgggcc
ttagagagtgaggcgggctcgcccccggctggcctggatatggacacgtttgacagtggc
ttcgcgggctctgactgcagcagccctgtggagtgtgacttcaccagtcccggggatgaa
ggccccccccggagctacctccgccagtgggtgatcattccctcgccactctcaagccct
ggaccccaggccagctag

DBGET integrated database retrieval system