KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401347Help
Entry
100401347         CDS       T03264                                 

Gene name
TRADD
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04622  RIG-I-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100401347 (TRADD)
   04064 NF-kappa B signaling pathway
    100401347 (TRADD)
   04668 TNF signaling pathway
    100401347 (TRADD)
   04071 Sphingolipid signaling pathway
    100401347 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100401347 (TRADD)
   04217 Necroptosis
    100401347 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100401347 (TRADD)
   04657 IL-17 signaling pathway
    100401347 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100401347 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100401347 (TRADD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100401347 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100401347 (TRADD)
   05162 Measles
    100401347 (TRADD)
   05164 Influenza A
    100401347 (TRADD)
   05160 Hepatitis C
    100401347 (TRADD)
   05168 Herpes simplex virus 1 infection
    100401347 (TRADD)
   05163 Human cytomegalovirus infection
    100401347 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100401347 (TRADD)
   05169 Epstein-Barr virus infection
    100401347 (TRADD)
   05165 Human papillomavirus infection
    100401347 (TRADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRADD_N Death RNA_binding
Motif
Other DBs
NCBI-GeneID: 100401347
NCBI-ProteinID: XP_008984275
Ensembl: ENSCJAG00000016502
UniProt: F6WBD6
Position
20
AA seq 312 aa AA seqDB search
MAAGQNGHEECVGSAYLFVESSLDKVVLSDAYVHPQQKMAVYRALQTALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCSRFLRAYREGALCAALQRSLAAAVSQHSLSLQLELRA
GAERLDALLADEEYCLSCILAQQPDRLRDEELAELEDALRNLKCGLGAQGGDREVSLDPS
QLPVPSLSEVKPRPPPTPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRS
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGSLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgtgtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgtgcacccccagcagaagatggca
gtgtacagggctttgcagactgccttggcagagagcggtgggagcccggacgtgctgcag
atgctgaagatccatcgcagcgacccgcagctgatcgtgcagttgcgattctgtgggcgc
cagccctgcagccgcttcctccgcgcctaccgcgagggggcgctatgcgccgcgctgcag
aggagcctggcggccgccgtctcccaacactcgctatcgctgcaactggagctgcgcgcc
ggcgccgaacggctggacgctttgctggcggacgaggagtactgtttgagttgcatccta
gcccagcagcccgaccggctccgggacgaagaactggctgagctggaggatgcactgagg
aacctgaagtgcggcttgggggcccagggtggcgacagggaggtctctttggacccctct
cagctccccgtgccctctctgtcggaggtgaagccgcggccgcctccaacgcctgcccag
acttttctgttccagggtcagcctgtagtgaaccggccgctgagcctgcaggaccaacag
acgttcgcacgctccgtgggcctaaagtggcgcaaggtggggcgctcgctgcagcggagc
tgcagagcgctgcgggacccggcgctggactcgctggcctatgagtacgagcgcgagggg
ttgtatgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcacttgaggagaatgagctcaccagcctggcagaggac
ttgctgggcctgactgatcccaatggcagcctggcctag

DBGET integrated database retrieval system