KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401379Help
Entry
100401379         CDS       T03264                                 

Gene name
TNFSF11, TNLG6B
Definition
(RefSeq) tumor necrosis factor superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04380  Osteoclast differentiation
cjc04917  Prolactin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05224  Breast cancer
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100401379 (TNFSF11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100401379 (TNFSF11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100401379 (TNFSF11)
   04928 Parathyroid hormone synthesis, secretion and action
    100401379 (TNFSF11)
  09158 Development
   04380 Osteoclast differentiation
    100401379 (TNFSF11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    100401379 (TNFSF11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100401379 (TNFSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100401379 (TNFSF11)
   04090 CD molecules [BR:cjc04090]
    100401379 (TNFSF11)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100401379 (TNFSF11)
CD molecules [BR:cjc04090]
 Proteins
  100401379 (TNFSF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 100401379
NCBI-ProteinID: XP_002749065
Ensembl: ENSCJAG00000017622
UniProt: A0A0U5JXT4
Position
5
AA seq 317 aa AA seqDB search
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHPPPAASRSMFVALLGLGLGQV
VCSVALFLYFRAQMDPNRISEDGTHCIYRILRLHENEDFQDTSLESEDTKLLPDSCRRIK
QAFQGAVQKELQHIIGSQYIRAEKAVMDASGLDLARKSKLEAQPFAHLTINATSIPSGSR
KVSLSSWYHDRGWAKISNMTYNNGKLTVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIRIPRSQTLMKGGSTKYWSGNSEYHFYSINVGGLFKLRSGEEISVEVSNPSLLD
PDQDATYFGAFKVRDTD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccagccgagactacaccaagtacctgcgaggctcggaggagatgggcggc
gggcccggagccccgcacgagggtcccctgcacgccccgccgccgcccgcgccgcacccg
ccccccgccgcctcccgctccatgttcgtggccctcctggggctggggctgggccaggtc
gtctgcagcgtcgccctgttcctctacttcagagcgcagatggatcctaatagaatatca
gaagacggtactcactgcatttatagaattttgagactccacgaaaatgaagattttcaa
gacacaagtctggagagtgaagacacaaaattattacctgattcatgcaggagaattaaa
caggcctttcaaggagccgtgcaaaaggaattacagcatatcattggatcacagtacatc
agagcagagaaagcggtgatggatgcttcaggattagatctggccaggaagagcaagctt
gaagctcagccttttgctcatctcactattaatgccaccagcatcccatctggttcgcgt
aaagtgagtctgtcttcttggtaccatgatcggggttgggccaagatctccaacatgact
tataacaacggaaaactaacagttaatcaggatggcttttattacctgtatgccaacatt
tgctttcggcaccacgaaacttcaggagacctagctacggagtatcttcagctaatggtg
tacgtcactaaaaccagcatcagaatcccacgttctcagaccctgatgaaaggaggaagc
accaaatactggtcagggaattctgaataccacttttattccataaacgttggaggactt
tttaagctgcggtctggtgaggagatcagcgtcgaagtctccaacccctccctactggat
ccggatcaggatgcaacgtactttggggcttttaaagttcgagatacagattga

DBGET integrated database retrieval system