KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401462
Entry
100401462         CDS       T03264                                 
Symbol
APH1A
Name
(RefSeq) aph-1 homolog A, gamma-secretase subunit
  KO
K06172  gamma-secretase subunit APH-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04330  Notch signaling pathway
cjc05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100401462 (APH1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100401462 (APH1A)
SSDB
Motif
Pfam: Aph-1 Peptidase_M3_N
Other DBs
NCBI-GeneID: 100401462
NCBI-ProteinID: XP_017821725
Ensembl: ENSCJAG00000009786
UniProt: U3DJW2
Position
18:complement(4241486..4259850)
AA seq 265 aa
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSVQ
RSLLCRRQEDSRVMVYSALRIPPED
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggggctgcggtgtttttcggctgcactttcgtcgcgttcggcccggccttcgcgctt
ttcttgatcactgtggctggggacccgcttcgcgttatcatcctggtcgcaggggcattt
ttctggctggtctccctgctcttggcctctgtggtctggttcatcttggtccatgtgact
gaccggtcagatgcccggctccagtacggcctcctgatttttggtgctgctgtctctgtc
cttctgcaggaggtgttccgctttgcctactacaagctgcttaagaaggcagatgagggg
ttagcatcgctgagtgaggacggaagatcacccatctccatccgccagatggcctatgtt
tctggtctctccttcggtatcatcagtggtgtcttctctgttatcaatattttggctgat
gcacttgggccaggtgtggttgggatccatggagactcaccctattacttcctgacttca
gcctttctgacagcagccattatcctgctccataccttttggggagttgtgttctttgat
gcctgtgagaggagacggtactgggctttgggcctggtggttgggagtcacctactgaca
tcaggactgacattcctgaacccatggtatgaggccagcctgctgcccatctatgcagtc
actgtttccatggggctctgggccttcatcacagctggaggttccctccgaagtgttcag
cgcagcctcttgtgccgacggcaggaggacagtcgggtgatggtgtattctgccctgcgc
atcccacccgaggactga

DBGET integrated database retrieval system