KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401524Help
Entry
100401524         CDS       T03264                                 

Gene name
LTBR
Definition
(RefSeq) lymphotoxin beta receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100401524 (LTBR)
   04066 HIF-1 signaling pathway
    100401524 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100401524 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100401524 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100401524 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100401524 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100401524 (LTBR)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100401524 (LTBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 TMEM252
Motif
Other DBs
NCBI-GeneID: 100401524
NCBI-ProteinID: XP_009001710
Ensembl: ENSCJAG00000000706
Position
9
AA seq 431 aa AA seqDB search
MRLPWATSARGLAWGPLVLGLVGLLAVSQPQVVPPYGSENQTCRDQEKEYYELRHRICCS
RCPPGTYVSAKCSRSSDTVCAACTENSYNEFWNYLTICQLCRPCDPVMGLEETAPCTSKQ
KTQCRCKPGMFCAAETSECTHCELLSDCPPGTEADLKDKVGKGNNHCIPCKAGHFQNTSS
PSARCQPHTRCEDQGLVETAPGTAQSDTSCRNPLEPLPPEMPGTMLMLAILLPLTFFLLL
AIVFACIWKSHPSLCRKLGSLLKRHPEGEGSNPAVGSWEPPKANLHSLDLEQPLLPNSGD
VSPVSTGLPTSSALEEGVLQQQSPLGQIREPQLEPGEQGQVPHGTNGIHVTGGSMTITGN
IYIYNGPVLGGPPGPGDTPATPEPPYPIPEEGDPGPPWLSTPSQEDGKAWHLAETEHCDT
IPSNSHPVCHP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgccttgggccacctctgcccgcggcctggcctgggggcctctggtgctgggc
ctcgttgggctcctagcagtatcccagccccaggtggtgcctccatacgggtcggagaac
cagacctgcagggaccaggaaaaggaatactacgagctcaggcaccgcatctgctgctcc
cgctgcccgccaggcacctatgtctcagctaaatgcagccgcagcagcgacacagtttgt
gctgcatgtactgaaaattcctacaatgagttctggaactacctgaccatctgccagctg
tgccgcccctgtgacccagtgatgggcctcgaggagactgccccctgcacaagcaaacag
aagacccagtgccgctgcaagccgggaatgttctgtgctgctgagacctccgagtgtaca
cactgcgagctactttctgactgtccacctggcactgaagccgatctcaaagataaagtt
ggtaagggtaacaaccactgcatcccctgcaaggcagggcacttccagaacacctcctcc
cccagtgcccgctgccagccccacaccaggtgcgaggaccaaggtctggtggagacagct
ccaggcactgcccaatccgacacaagctgcagaaatccattagagccactgcccccagag
atgccaggaaccatgctgatgctggccatcctactgccgctgactttctttctgctcctc
gccattgtcttcgcctgcatctggaagagccacccttctctctgcaggaaactgggatcg
ctgctcaagaggcatccagagggagaggggtccaatcctgccgttggaagctgggaacct
ccgaaggccaatctacactcccttgacctggaacagccactgctgcccaactctggagat
gtctccccagtctccactgggctccccacaagctcagctttggaggaaggggtgctgcaa
cagcagagtcctctgggtcagatcagggagccacagttggaacctggggagcagggccag
gtgccccatggtaccaacggcattcatgtcaccggcgggtctatgacaatcactggcaat
atctacatctacaatggaccagtactggggggaccaccgggccctggagataccccagct
actccagaacctccataccccattcccgaagagggggaccctggccctccctggctctct
acaccctcccaggaagacggcaaggcttggcacctggcagagacagagcactgtgatacc
ataccctctaacagtcacccagtttgtcacccatga

DBGET integrated database retrieval system