KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401718Help
Entry
100401718         CDS       T03264                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100401718 (CYCS)
   04215 Apoptosis - multiple species
    100401718 (CYCS)
   04115 p53 signaling pathway
    100401718 (CYCS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100401718 (CYCS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100401718 (CYCS)
   05222 Small cell lung cancer
    100401718 (CYCS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100401718 (CYCS)
   05012 Parkinson disease
    100401718 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    100401718 (CYCS)
   05016 Huntington disease
    100401718 (CYCS)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100401718 (CYCS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100401718 (CYCS)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100401718 (CYCS)
   05152 Tuberculosis
    100401718 (CYCS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100401718 (CYCS)
   05162 Measles
    100401718 (CYCS)
   05164 Influenza A
    100401718 (CYCS)
   05161 Hepatitis B
    100401718 (CYCS)
   05160 Hepatitis C
    100401718 (CYCS)
   05168 Herpes simplex virus 1 infection
    100401718 (CYCS)
   05163 Human cytomegalovirus infection
    100401718 (CYCS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100401718 (CYCS)
   05169 Epstein-Barr virus infection
    100401718 (CYCS)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100401718 (CYCS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100401718 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100401718
NCBI-ProteinID: XP_002760914
Ensembl: ENSCJAG00000017274
UniProt: F7AI40
Position
19
AA seq 105 aa AA seqDB search
MGDVEKGKRIFIQKCSQCHTVEKGGKHKTGPNLHGIFGRKTGQASGFTYTEANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKGEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaggatttttattcagaagtgttcccaatgtcacacg
gtggaaaagggaggcaagcacaagactgggcctaatctccatggtatctttgggcggaag
acaggtcaggcctctggattcacttacactgaagccaataaaaacaaaggcatcatctgg
ggagaggatacactgatggaatatttggagaatcccaagaagtatatccctggaacaaaa
atgatctttgtcggcattaagaagaagggagaaagggaagacttaatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406761Help
Entry
100406761         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100406761
   04215 Apoptosis - multiple species
    100406761
   04115 p53 signaling pathway
    100406761
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406761
  09162 Cancer: specific types
   05210 Colorectal cancer
    100406761
   05222 Small cell lung cancer
    100406761
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100406761
   05012 Parkinson disease
    100406761
   05014 Amyotrophic lateral sclerosis (ALS)
    100406761
   05016 Huntington disease
    100406761
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100406761
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100406761
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100406761
   05152 Tuberculosis
    100406761
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100406761
   05162 Measles
    100406761
   05164 Influenza A
    100406761
   05161 Hepatitis B
    100406761
   05160 Hepatitis C
    100406761
   05168 Herpes simplex virus 1 infection
    100406761
   05163 Human cytomegalovirus infection
    100406761
   05167 Kaposi sarcoma-associated herpesvirus infection
    100406761
   05169 Epstein-Barr virus infection
    100406761
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100406761
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100406761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100406761
NCBI-ProteinID: XP_002756982
Ensembl: ENSCJAG00000035144
UniProt: A0A2R8MFU0
Position
13
AA seq 105 aa AA seqDB search
MGDVEKGKRIFIQKCSQCHTVEKGGKHKTGPNLHGIFGQKTGQASGFTYTEANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKGEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaggatttttattcagaagtgttcccaatgtcacacg
gtggaaaagggaggcaagcacaagactgggcctaatctccatggtatctttgggcagaag
acaggtcaggcctctggattcacttacactgaagccaataagaacaaaggcatcatctgg
ggagaggatacactgatggaatatttggagaatcccaagaagtatatccctggaacaaaa
atgatctttgtcggcattaagaagaagggagaaagggaagacttaatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413276Help
Entry
100413276         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100413276
   04215 Apoptosis - multiple species
    100413276
   04115 p53 signaling pathway
    100413276
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100413276
  09162 Cancer: specific types
   05210 Colorectal cancer
    100413276
   05222 Small cell lung cancer
    100413276
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100413276
   05012 Parkinson disease
    100413276
   05014 Amyotrophic lateral sclerosis (ALS)
    100413276
   05016 Huntington disease
    100413276
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100413276
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100413276
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100413276
   05152 Tuberculosis
    100413276
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100413276
   05162 Measles
    100413276
   05164 Influenza A
    100413276
   05161 Hepatitis B
    100413276
   05160 Hepatitis C
    100413276
   05168 Herpes simplex virus 1 infection
    100413276
   05163 Human cytomegalovirus infection
    100413276
   05167 Kaposi sarcoma-associated herpesvirus infection
    100413276
   05169 Epstein-Barr virus infection
    100413276
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100413276
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100413276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100413276
NCBI-ProteinID: XP_002745878
UniProt: A0A2R8M9R9
Position
3
AA seq 105 aa AA seqDB search
MGDVEKGKRIFIQKCSQCHTVEKGGKHKTGPNLHGIFGRKTGQASGFTYTEANKNKGIIW
GEDTLMEYLEKSKKYIPGTKMIFVGIKKKGEREDLIGYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaggatttttatccagaagtgttcccaatgtcacact
gtggaaaagggaggcaagcacaagactgggcctaatctccatggtatctttgggcggaag
acaggtcaggcctctggattcacttacactgaagccaataagaacaaaggcatcatctgg
ggagaggatacactgatggaatatttggagaagtccaagaagtatattcctggaacaaaa
atgatctttgtcggcattaagaagaagggagaaagggaagatttaataggttatctcaaa
aaagctactaatgagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108588095Help
Entry
108588095         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108588095
   04215 Apoptosis - multiple species
    108588095
   04115 p53 signaling pathway
    108588095
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108588095
  09162 Cancer: specific types
   05210 Colorectal cancer
    108588095
   05222 Small cell lung cancer
    108588095
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108588095
   05012 Parkinson disease
    108588095
   05014 Amyotrophic lateral sclerosis (ALS)
    108588095
   05016 Huntington disease
    108588095
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108588095
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108588095
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108588095
   05152 Tuberculosis
    108588095
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108588095
   05162 Measles
    108588095
   05164 Influenza A
    108588095
   05161 Hepatitis B
    108588095
   05160 Hepatitis C
    108588095
   05168 Herpes simplex virus 1 infection
    108588095
   05163 Human cytomegalovirus infection
    108588095
   05167 Kaposi sarcoma-associated herpesvirus infection
    108588095
   05169 Epstein-Barr virus infection
    108588095
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108588095
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108588095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 108588095
NCBI-ProteinID: XP_017819466
Position
14
AA seq 105 aa AA seqDB search
MGDVEKGKIIFIQKCSQCHTVEKGGKHKTGPHLHGIFGRKTGQASGFTYTEANKNKGIIW
GEDTLMDYLENPKKYIPGTKMIFVSLKKKGEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgtggagaaaggcaagataatttttattcagaagtgttcccaatgtcacacc
gtggaaaagggaggcaagcacaagactgggcctcatctccatggtatctttgggcggaag
acaggacaggcctctggattcacttatactgaagccaataagaacaaaggcatcatctgg
ggagaggatacactgatggattatttggagaatcccaaaaaatatatccctggaacaaaa
atgatctttgtcagccttaagaagaagggagagagggaagacttaatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108591055Help
Entry
108591055         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108591055
   04215 Apoptosis - multiple species
    108591055
   04115 p53 signaling pathway
    108591055
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108591055
  09162 Cancer: specific types
   05210 Colorectal cancer
    108591055
   05222 Small cell lung cancer
    108591055
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108591055
   05012 Parkinson disease
    108591055
   05014 Amyotrophic lateral sclerosis (ALS)
    108591055
   05016 Huntington disease
    108591055
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108591055
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108591055
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108591055
   05152 Tuberculosis
    108591055
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108591055
   05162 Measles
    108591055
   05164 Influenza A
    108591055
   05161 Hepatitis B
    108591055
   05160 Hepatitis C
    108591055
   05168 Herpes simplex virus 1 infection
    108591055
   05163 Human cytomegalovirus infection
    108591055
   05167 Kaposi sarcoma-associated herpesvirus infection
    108591055
   05169 Epstein-Barr virus infection
    108591055
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108591055
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108591055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 108591055
NCBI-ProteinID: XP_017826264
Position
4
AA seq 107 aa AA seqDB search
MGDVEKDKRIFIQKCHTVEKGGKHKTGPNLHGIFGQKTGQASGLKANKNKGIIWGEDTLM
EYLENPKKYVPGTKMIFVGIKKNGERQDLVSYLTKLLMSNNWPLPYL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaagacaagaggatttttattcagaagtgtcacaccgtggaaaag
ggaggcaagcacaagactgggcctaatctccatggtatctttgggcagaagacaggtcag
gcctctggattaaaagccaataagaacaaaggcattatctggggagaggatacactgatg
gaatatttggagaatcccaagaagtatgtccctggaacaaaaatgatctttgtgggcatt
aagaagaacggagaaaggcaagacttagtatcttatctcacaaagctactaatgagtaat
aattggccactgccttatttataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108591937Help
Entry
108591937         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108591937
   04215 Apoptosis - multiple species
    108591937
   04115 p53 signaling pathway
    108591937
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108591937
  09162 Cancer: specific types
   05210 Colorectal cancer
    108591937
   05222 Small cell lung cancer
    108591937
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108591937
   05012 Parkinson disease
    108591937
   05014 Amyotrophic lateral sclerosis (ALS)
    108591937
   05016 Huntington disease
    108591937
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108591937
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108591937
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108591937
   05152 Tuberculosis
    108591937
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108591937
   05162 Measles
    108591937
   05164 Influenza A
    108591937
   05161 Hepatitis B
    108591937
   05160 Hepatitis C
    108591937
   05168 Herpes simplex virus 1 infection
    108591937
   05163 Human cytomegalovirus infection
    108591937
   05167 Kaposi sarcoma-associated herpesvirus infection
    108591937
   05169 Epstein-Barr virus infection
    108591937
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108591937
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108591937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 108591937
NCBI-ProteinID: XP_017828554
Position
5
AA seq 105 aa AA seqDB search
MGDVEKGGKIFLQKCAQCHTVEKGGKRKTGPNLHGLFRRKAGQAIGFSYTDANKNKSITW
GEDTLMEYSENPEKYIPGTKMIFDSIKKKAERTDFIAYLKKSASE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcgggaaaatttttcttcagaagtgtgcccagtgccacacc
gtggaaaagggaggcaagcgcaagactgggcctaatctccatggtctattcaggcgcaag
gcaggtcaggccattggattttcttacacagatgccaataagaacaaaagcatcacctgg
ggagaggatacactgatggagtattcggagaatcccgagaagtacatccctggaacaaaa
atgatcttcgacagcattaagaagaaggcagaaaggacagacttcatagcttatctcaaa
aaatctgctagtgagtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108592162Help
Entry
108592162         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108592162
   04215 Apoptosis - multiple species
    108592162
   04115 p53 signaling pathway
    108592162
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108592162
  09162 Cancer: specific types
   05210 Colorectal cancer
    108592162
   05222 Small cell lung cancer
    108592162
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108592162
   05012 Parkinson disease
    108592162
   05014 Amyotrophic lateral sclerosis (ALS)
    108592162
   05016 Huntington disease
    108592162
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108592162
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108592162
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108592162
   05152 Tuberculosis
    108592162
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108592162
   05162 Measles
    108592162
   05164 Influenza A
    108592162
   05161 Hepatitis B
    108592162
   05160 Hepatitis C
    108592162
   05168 Herpes simplex virus 1 infection
    108592162
   05163 Human cytomegalovirus infection
    108592162
   05167 Kaposi sarcoma-associated herpesvirus infection
    108592162
   05169 Epstein-Barr virus infection
    108592162
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108592162
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108592162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 108592162
NCBI-ProteinID: XP_017828851
Ensembl: ENSCJAG00000032146
Position
6
AA seq 105 aa AA seqDB search
MGDVEKGKRIFIQKCSQCHTVEKGGKHKTGPNLHVIFGWKTGQASGFTYTEANKNKGIIW
GEDTLMEYLENLKKYIPGTKMIFVGIKKKGEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaggatttttattcagaagtgttcccaatgtcacacc
gtggaaaagggaggcaagcacaagactgggcctaatctccatgttatctttgggtggaag
acaggtcaggcctctggattcacttacactgaagccaataagaacaaaggcatcatctgg
ggagaggatacactgatggaatatttggagaatctcaagaagtatatccctggaacaaaa
atgatctttgtcggcattaagaagaagggagaaagggaagacttaatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108593648Help
Entry
108593648         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108593648
   04215 Apoptosis - multiple species
    108593648
   04115 p53 signaling pathway
    108593648
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108593648
  09162 Cancer: specific types
   05210 Colorectal cancer
    108593648
   05222 Small cell lung cancer
    108593648
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108593648
   05012 Parkinson disease
    108593648
   05014 Amyotrophic lateral sclerosis (ALS)
    108593648
   05016 Huntington disease
    108593648
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108593648
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108593648
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108593648
   05152 Tuberculosis
    108593648
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108593648
   05162 Measles
    108593648
   05164 Influenza A
    108593648
   05161 Hepatitis B
    108593648
   05160 Hepatitis C
    108593648
   05168 Herpes simplex virus 1 infection
    108593648
   05163 Human cytomegalovirus infection
    108593648
   05167 Kaposi sarcoma-associated herpesvirus infection
    108593648
   05169 Epstein-Barr virus infection
    108593648
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108593648
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108593648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C DDE_Tnp_1 UPF0128
Motif
Other DBs
NCBI-GeneID: 108593648
NCBI-ProteinID: XP_017832966
UniProt: A0A2R8PGB1
Position
10
AA seq 104 aa AA seqDB search
MGDVEKDKIFAQKCAQWHTMENRGKHKTGANLHALFGQRTGQAIGFSYTDANKDKGITWG
EDTLMEYLENPKKYIPGTKMIFAGIKKKAERADLIAYLKKATNE
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaagacaagatttttgctcagaagtgtgcccagtggcacaccatg
gaaaacagaggcaagcacaagactggggctaatctccatgctctctttgggcagaggaca
ggtcaggctattggattctcttacacagatgccaataaggacaaaggcatcacctgggga
gaggataccctgatggagtatttggagaatcccaagaagtacatccccggaacaaaaatg
atctttgctggcattaagaagaaggcagaaagggcagacttaatagcttatctcaaaaaa
gctactaatgaatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108593819Help
Entry
108593819         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108593819
   04215 Apoptosis - multiple species
    108593819
   04115 p53 signaling pathway
    108593819
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108593819
  09162 Cancer: specific types
   05210 Colorectal cancer
    108593819
   05222 Small cell lung cancer
    108593819
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108593819
   05012 Parkinson disease
    108593819
   05014 Amyotrophic lateral sclerosis (ALS)
    108593819
   05016 Huntington disease
    108593819
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108593819
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108593819
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108593819
   05152 Tuberculosis
    108593819
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108593819
   05162 Measles
    108593819
   05164 Influenza A
    108593819
   05161 Hepatitis B
    108593819
   05160 Hepatitis C
    108593819
   05168 Herpes simplex virus 1 infection
    108593819
   05163 Human cytomegalovirus infection
    108593819
   05167 Kaposi sarcoma-associated herpesvirus infection
    108593819
   05169 Epstein-Barr virus infection
    108593819
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108593819
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108593819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 108593819
NCBI-ProteinID: XP_017833425
Position
11
AA seq 105 aa AA seqDB search
MGDVEKGKRIFIQKCSQCHTVEKGGKHKTGPNFHGIFGWKTGQSSGFTYTEANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVDIKKKGEREDLIAYLKKAINE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaggatttttattcagaagtgttcccaatgtcacacc
gtggaaaagggaggcaagcacaagactgggcctaatttccatggtatctttgggtggaag
acaggtcagtcctctggattcacttacactgaagccaataaaaacaaaggcatcatctgg
ggagaggatacactgatggaatatctggagaatcccaagaagtatatccctggaacaaaa
atgatctttgtcgacatcaagaagaagggagaaagggaagacttaatagcttatctcaaa
aaagctattaatgagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108593835Help
Entry
108593835         CDS       T03264                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05222  Small cell lung cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108593835
   04215 Apoptosis - multiple species
    108593835
   04115 p53 signaling pathway
    108593835
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108593835
  09162 Cancer: specific types
   05210 Colorectal cancer
    108593835
   05222 Small cell lung cancer
    108593835
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108593835
   05012 Parkinson disease
    108593835
   05014 Amyotrophic lateral sclerosis (ALS)
    108593835
   05016 Huntington disease
    108593835
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108593835
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108593835
  09171 Infectious disease: bacterial
   05134 Legionellosis
    108593835
   05152 Tuberculosis
    108593835
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108593835
   05162 Measles
    108593835
   05164 Influenza A
    108593835
   05161 Hepatitis B
    108593835
   05160 Hepatitis C
    108593835
   05168 Herpes simplex virus 1 infection
    108593835
   05163 Human cytomegalovirus infection
    108593835
   05167 Kaposi sarcoma-associated herpesvirus infection
    108593835
   05169 Epstein-Barr virus infection
    108593835
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108593835
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108593835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 108593835
NCBI-ProteinID: XP_017833468
Position
11
AA seq 105 aa AA seqDB search
MGGVEKGTKIFFQKCSQCHIIEKGGKHKTGPNLHGLLGQKTGQSIGFSYTDANKNKGITW
GKDTLMKYWENPKKCIPGTKMIFAGIKKKEERADLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgttgagaaaggcacaaagattttttttcagaagtgttcccagtgccacatc
attgaaaagggaggcaagcacaagactgggcctaatctccatggtctccttgggcagaag
acaggtcagtccattggattctcttacacagatgccaataagaacaaaggcatcacatgg
ggaaaggatacattgatgaagtattgggagaatcccaagaagtgtatccctggaacaaaa
atgatctttgctggcattaagaagaaagaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system