KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401971Help
Entry
100401971         CDS       T03264                                 

Gene name
CALR
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04145  Phagosome
cjc04612  Antigen processing and presentation
cjc05142  Chagas disease (American trypanosomiasis)
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100401971 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100401971 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100401971 (CALR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100401971 (CALR)
   05170 Human immunodeficiency virus 1 infection
    100401971 (CALR)
   05168 Herpes simplex virus 1 infection
    100401971 (CALR)
   05163 Human cytomegalovirus infection
    100401971 (CALR)
   05169 Epstein-Barr virus infection
    100401971 (CALR)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100401971 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100401971 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:cjc04091]
    100401971 (CALR)
Chaperones and folding catalysts [BR:cjc03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   100401971 (CALR)
Lectins [BR:cjc04091]
 Calnexin / calreticulin
  100401971 (CALR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin MDM10
Motif
Other DBs
NCBI-GeneID: 100401971
NCBI-ProteinID: XP_002761834
Ensembl: ENSCJAG00000004650
UniProt: F7I5Y4
Position
22
AA seq 417 aa AA seqDB search
MLLSVPLLLGLLGLAAAEPAIYFKEQFLDGDGWTSRWIESKHKSDFGKFALSSGKFYGDQ
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPAASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPNIYTYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKDDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgctatccgtgccgctgctgctcggcctcctcggcctggctgccgccgagcccgcc
atctatttcaaggagcagtttctggacggagatgggtggacttcccgctggatcgaatcc
aaacacaagtcagattttggcaaatttgccctcagttccggcaagttctacggtgaccag
gagaaagataaaggtttgcagacaagccaggatgcacgcttttatgctctatcggccagt
tttgagccctttagcaacaaagggcagacactagtggtgcagttcacggtgaaacatgag
cagaacatcgactgtgggggcggctatgtgaagctgtttcctagtagtttggaccagacg
gacatgcacggagactcagaatacaacatcatgttcggtcctgacatctgtggccctggc
accaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggac
atccgttgcaaggatgatgagtttacacacctgtacacactgattgtgcgaccggacaat
acctacgaggtgaagatcgacaacagccaggtggagtcggggtccttggaggacgattgg
gactttctgccacccaagaagataaaggatcctgctgcttcaaaaccggaagactgggat
gagcgggccaagatcgatgatcccacagactccaagcctgaggactgggacaagcctgag
catattcctgaccctgatgccaagaagcctgaggactgggatgaagagatggatggagag
tgggaacccccagtgattcagaaccctgagtacaagggtgagtggaagccccgacagatc
gacaacccagattacaagggcacttggatccacccagaaattgacaatcccgagtattcc
cctgatcccaatatctatacctatgataactttggtgtgctgggcctggacctctggcag
gtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgctgag
gagtttggcaatgagacgtggggtgtaacaaaggcagcagagaagcaaatgaaggacaaa
caggatgaggagcagaggcttaaggaggaggaagaagacaagaagcgcaaagaggaggag
gaggcagaggacaaggacgatgacgaggacaaagatgaggatgaagaggatgaggaggac
aaggaagaagatgaggaggaagatgtccctggccaggccaaggacgagctgtag

DBGET integrated database retrieval system