KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401978Help
Entry
100401978         CDS       T03264                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01524  Platinum drug resistance
cjc04014  Ras signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04115  p53 signaling pathway
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04621  NOD-like receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05145  Toxoplasmosis
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05212  Pancreatic cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100401978 (BCL2L1)
   04630 Jak-STAT signaling pathway
    100401978 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100401978 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100401978 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100401978 (BCL2L1)
   04137 Mitophagy - animal
    100401978 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    100401978 (BCL2L1)
   04215 Apoptosis - multiple species
    100401978 (BCL2L1)
   04115 p53 signaling pathway
    100401978 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100401978 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100401978 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    100401978 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100401978 (BCL2L1)
   05225 Hepatocellular carcinoma
    100401978 (BCL2L1)
   05220 Chronic myeloid leukemia
    100401978 (BCL2L1)
   05222 Small cell lung cancer
    100401978 (BCL2L1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100401978 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100401978 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    100401978 (BCL2L1)
   05162 Measles
    100401978 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    100401978 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100401978 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100401978 (BCL2L1)
   01524 Platinum drug resistance
    100401978 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100401978 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100401978 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100401978 (BCL2L1)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100401978 (BCL2L1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100401978 (BCL2L1)
Transporters [BR:cjc02000]
 Other Transporters
  Pores ion channels [TC:1]
   100401978 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 100401978
NCBI-ProteinID: XP_002747378
Ensembl: ENSCJAG00000020780
UniProt: F7IT34
Position
5
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLA
DSPVVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgattcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gacagcccagtggtgaatggagccacgggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcactgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcatttagtgacctgacatcccagctccacatcacccccgggacagcgtat
cagagctttgaacaggtagtgaacgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctatggaaacaatgcggca
gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactctttagtcggaaatga

DBGET integrated database retrieval system