KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402026
Entry
100402026         CDS       T03264                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100402026 (RDH5)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100402026 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 100402026
NCBI-ProteinID: XP_002752628
Ensembl: ENSCJAG00000008011
UniProt: F7IBF6
Position
9
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDWQSLPASDAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVETHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLQVQERIMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVH
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctccctctgctgctgggtgccttgctctgggcagtgctgtggttgctcagggac
tggcagagcctgcctgccagcgatgccttcgtcttcatcaccggctgtgactcaggcttt
gggcgccttctggcactgcagctggaccagagaggcttccgagtcctggccagctgcctg
accccttccggggccgaggacctgcagcgggtggcctcctcccggctccacaccaccctg
ctggatatcactgatcctcagagcgtccaacaggcagccaagtgggtggagacacacgtt
aaggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccatggctgacccgggatgatttccagcgggtgctgaatgtgaacacaatgggtccc
atcggggtcacccttgccctgctgcctctcctgcagcaagcccggggacgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaaattt
ggcctggaggccttctctgacagcctgaggcgggatgtggctcattttgggatacgcgtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctagagagtctggagaaa
actctacaggcctgctgggcccggctacctcctgccacacaggcccactatgggggggcc
ttcctcaccaagtacctccaagtgcaagagcgcatcatgaacctgatctgcgacccggac
ctaaccaaggtgagccgatgcctggagcatgccctgactgctcgacacccccgaacccgc
tacagcccaggctgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccaagcagtccactga

DBGET integrated database retrieval system