KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402158Help
Entry
100402158         CDS       T03264                                 

Gene name
PIDD1, LRDD, PIDD
Definition
(RefSeq) p53-induced death domain protein 1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100402158 (PIDD1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100402158 (PIDD1)
   04115 p53 signaling pathway
    100402158 (PIDD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 Peptidase_S68 ZU5 Death LRR_4
Motif
Other DBs
NCBI-GeneID: 100402158
NCBI-ProteinID: XP_009007002
Ensembl: ENSCJAG00000011846
Position
11
AA seq 984 aa AA seqDB search
MQGAHEVSPTLHPRPRWLKSSPLQPESLFPQREEGSRSPLPLPLQLPQALPGQACLRAGT
CLASKDSWWVMFAAVEGPELEAVAAAAEDALEAAGAEDALEAAGAGSRALPFLGGNRLSL
DLSPGGCHCLLRLCVQQPFQLLQVEFLRLSTHEDPQLLEATLAQVPRSLSRLRSLVLKGG
QRRDTLGACLRGALTTLPAGLRGLAHLAHLDLSFNSLETLPACILRMRGLGALLLSHNCL
SELPEALGTLPALTFLAVTHNRLQMLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGNLL
ELNLASNRLQSLPASLAGLRSLRLLVVHSNLLASVPASLARLPLLTRLDLRDNRLRDLPP
ELLDAPFVRLQGNPLGEALPDAPSSPGAALVPEMPRLFLTSDLDSFPVTPGGCSVTLACG
VRLQFPAGATITPITVRYRVLLPEPGLVPLGPHDALLSYVLELQPHGVAFQQDVGLWLLF
TPPRAWRCREVVVRTRNDSSWSDLETFLEEEAPKRLWAHCQVPHFSWFLVVSRPVSNACL
VPPEGTLLCSSGHPGVKVIFPAGATEEPRRVSMQVVRVAGQELRALLGEPEAAVSPLLCL
AQSGPPSFLRPVTVQLPLPSGVTGSVWTAPVCTCCTGPLLQPPGMTSQLRWSWSSPTCTR
ASRYWLWYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRR
LLERYRGPEPSDTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYV
TTTLDREAQAVRGQVSFYRGAVPVQVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGP
RRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGPDWPAVALHLGVSYRELQRIRHEFRD
DLDGQIRHMLFSWAERQAGHPGAVGHLVQALEQSDRQDLAEEVRAVLELGRRKYQDSIQR
TGLAPKDPEVPGSSAPQPSEPAQA
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtgcccatgaggtctcccccactctccaccccaggccccgatggctcaagagc
tccccactccagccagagtccctgtttccccaaagagaggagggctcccgctcacccctc
cccttgcctctgcagcttccccaggccctgcctggacaggcctgcctgcgtgctgggaca
tgtctggcctccaaggacagttggtgggtgatgtttgcagcagtggaggggccagagctg
gaggcagtggcagcggctgcagaagatgctttggaggctgcgggtgcagaagatgctttg
gaggctgcgggtgcagggtccagggcgctgcctttcctgggcggcaaccggctgagcttg
gacctgtcccccgggggctgccactgcctgcttcgcctgtgtgtccagcagccctttcag
ctgctgcaggtggagttcctgcgtctgagcactcacgaggaccctcagctgctggaggcc
accctggcccaggtgcctcggagtctgtcccgcctccgctccctggtcctcaaaggaggg
caacgccgggacacactcggcgcctgtctccggggcgccctgaccaccctacctgctggt
ttgcgcggcctggcccatctggcccacctggacctgagcttcaacagcctggagacgctg
ccagcctgtatcctgcggatgcgaggtctgggtgccctcttgctgtctcacaactgcctc
tccgagctgcctgaggctctggggaccctccccgccctcaccttcctcgccgtcacacac
aaccgcctgcagatgctgcccccagctctgggggccctgtccaccctgcagcgcctcgat
ctctctcagaaccttctggacacactgcctcctgagattggaggcctgggcaacctcctt
gaactcaacctggcctccaaccgactgcagagcctcccggcctccctggcggggctgcgg
tccttgcggctccttgtcgtgcacagcaacctcctggcctctgtgccagccagcctggcc
cgcctcccgctcctcacccggctcgacctgagggacaaccggctccgggacctgccccct
gagctgctggatgccccctttgtgcgcctgcaggggaaccccttgggcgaggccttgcca
gacgccccaagttccccaggggcagccctcgttccagaaatgcccaggctattcctgacc
tcagatttggacagctttcctgtgacccctggaggctgctccgtgaccctggcctgtggc
gtccgcctgcagttcccagcgggggccaccattacccccatcaccgtccgctatcgggtg
ttgctgccagagccgggcctcgtccccctgggccctcatgatgccctgctcagctatgtg
ctggagctgcagccccacggggtggccttccagcaggatgtgggcctgtggctgctcttc
acgcccccacgggcctggcgctgccgtgaggtcgtggtcaggacccggaatgacagcagc
tggagtgaccttgagaccttcctggaggaagaggcacccaagcggctctgggctcactgc
caggtgccccacttctcctggttccttgtggtctcccgccccgtgtccaacgcctgcctg
gtgccaccagaggggacactgctgtgctcctcaggtcatcctggggtcaaggtcatcttc
cccgctggggccactgaggagcctcgtagagtctccatgcaggtggtgcgcgtggctggc
caagagctgcgagccctcctgggagagcctgaggccgcagtgagcccactgctgtgcctc
gcacagagcggcccccccagcttcctccgacctgtcaccgtgcagctgcctctgccctct
ggtgtcacaggctcagtctggaccgctcccgtctgcacctgttgtactgggcccctcctg
cagccacctgggatgacatcacagctcaggtggtcctggagctcacccacctgtacgcgc
gcttccaggtactggctctggtacaccaccaagaactgcgtgggaggcctggctcggaag
gcctgggagcggctgcggctgcaccgtgtgaacctcatcgccctgcagcggcgccgggac
cctgagcaggtcctgctgcagtgcctgccccgaaacaaggtggacgccacccttcggcgg
ctgctggagcgctaccgtggcccggagccctccgacacggtggagatgttcgagggcgag
gagttctttgcggccttcgagcgaggcattgacgtggatgctgaccgccctgactgtgtg
gagggcagaatctgctttgtcttctactcacacctgaagaatgtgaaggaggtgtacgtg
accaccaccctggatcgggaggctcaggctgtgcggggccaggtgtccttctaccgtggc
gcagtgcccgtgcaggtgcccgaggaggcggaggctgcccggcagaggaagggtgcagac
gccctgtggatggccactctgcccatcaagctaccgaggcttcgggggtccgaagggcca
cggcgaggggctggcctctccttggcgcccctgaacctgggagatgctgagaccggcttt
ctgacgcagagcaacctcctgagcgtggctgggcgcttgggtccggactggccggccgtg
gccctgcacctgggcgtgtcctaccgagagctgcagcgcatccggcacgagttccgggat
gatctggacgggcagatccgtcacatgctcttctcctgggctgagcgtcaggctgggcac
ccgggagctgtggggcacctggtgcaggccctggagcagagtgaccggcaggacctggct
gaagaggtccgggcggtcttggagcttggccgccgcaagtaccaggacagcatccagcgc
acgggcttggcccccaaggaccccgaggtgcctggctcgtcggccccacagccctcagag
cctgcccaggcctag

DBGET integrated database retrieval system