KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402181Help
Entry
100402181         CDS       T03264                                 

Gene name
CYP8B1
Definition
(RefSeq) cytochrome P450, family 8, subfamily B, polypeptide 1
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00120  Primary bile acid biosynthesis
cjc01100  Metabolic pathways
cjc03320  PPAR signaling pathway
Module
cjc_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    100402181 (CYP8B1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100402181 (CYP8B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cjc00199]
    100402181 (CYP8B1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     100402181 (CYP8B1)
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     100402181 (CYP8B1)
Cytochrome P450 [BR:cjc00199]
 Cytochrome P450, animal type
  CYP8 family
   100402181 (CYP8B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100402181
NCBI-ProteinID: XP_002758490
Ensembl: ENSCJAG00000001698
Position
15
AA seq 501 aa AA seqDB search
MVLWGPVLGALLVVIVGYLCLPGILRQRRPWEPPLDKGTVPWLGHATAFRKNMFEFLKRM
RTKHGDVFTVQLGGQYFTFVMDPLSFGPILKDARRKLDFVEYAKKLVLKVFGYHSVQGDN
EMIHSASTKHLMGDGLKDLNEVMLDSLSFVMLKSKGRSLDASCWHEDSLFEFCYYILFTA
GYLSLFGYTKDKERDLLQAGKLFKGFRKFDLLFPRFVYSLLWPQERLEVGRLQRFFHKML
SVRHTQEKDGISNWLCNMLQFLREQGVPSAMQDKFSFMMLWASQGNTGPASFWTLFFLLK
YPEAIQAVREEATQVLGEARLETKQPFAFKLSALQHTTVLDSVVEETLRLRAAPTLLRMV
HEDYTLKMASGQEYLIRHGDILALFPYLSVHLDPDIHPEPTVFKYNRFLNPDGSRKVDFF
KAGKKTRHYTMPWGSGVSICPGRFFALSEVKLFVLLMVTHFDLELVDPDAPVPHVDPKRW
GFGMMQPSHDVRFRYRLRPTA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctggggtccagtgctgggagctctgctggtggtcattgtaggatacctgtgc
ctgccagggatacttcgacaacgcaggccctgggaaccccctctggacaagggcaccgtg
ccctggcttggccatgccacggctttccggaagaatatgtttgaatttctgaagcgcatg
aggaccaagcatggagatgtgttcacagtgcagctagggggccagtacttcaccttcgtc
atggaccccctctcttttggccccatcctcaaggatgcacggagaaaactagacttcgtc
gaatatgcaaaaaaactggtgctgaaggtatttggataccattcagtgcaaggggacaac
gagatgatacactcagccagtacgaagcatctgatgggggatggcctgaaggatcttaat
gaggtcatgctggacagcctgtcctttgtaatgctgaagtccaaaggccggagtctggat
gccagttgctggcatgaggacagcctctttgaattctgctattacatcttgttcacagct
ggatacctgagcttgttcggctacacgaaggacaaggagcgggacctgctacaggcagga
aagttattcaaggggttccgaaagtttgaccttcttttccccaggtttgtctactccctg
ctgtggcctcaggagcggctggaagtgggccgactccagcgtttctttcacaagatgctc
tctgtgagacacacccaggagaaggatggcatcagcaactggctgtgcaacatgcttcag
tttctgagggagcagggagtaccctcagcgatgcaggacaagttcagcttcatgatgctc
tgggcctcccagggaaacacagggcctgcctctttttggacgctctttttcctcctgaaa
tacccagaagccattcaggctgtgagggaggaagccacccaggtcctgggtgaggccagg
ctggagaccaagcagccctttgccttcaaactcagtgccctgcaacacaccacagtcctg
gacagtgtggtggaggagacgctgcggctaagggctgcacccaccctcctcaggatggtt
catgaagactataccctgaagatggccagtgggcaggaatatctgatccgccatggagac
atcctagccctctttccctacctctccgtgcacttggaccctgacatccaccctgagccc
actgtcttcaagtacaatcgcttcctcaaccctgatggcagccggaaagtggacttcttc
aaggcaggcaagaagacccgccactacaccatgccctggggttcaggcgtttccatctgc
cctgggagattctttgcactcagtgaggtgaagctctttgtcctgcttatggtcacacac
tttgacttagagttggtggaccctgatgcaccagtaccccacgtggacccgaagcgctgg
ggttttggcatgatgcagcccagccacgacgtgcgcttccgctaccgcctgcgtcccaca
gcgtga

DBGET integrated database retrieval system