KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402255Help
Entry
100402255         CDS       T03264                                 

Gene name
DDC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00380  Tryptophan metabolism
cjc01100  Metabolic pathways
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
Module
cjc_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
cjc_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100402255 (DDC)
   00360 Phenylalanine metabolism
    100402255 (DDC)
   00380 Tryptophan metabolism
    100402255 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100402255 (DDC)
   04726 Serotonergic synapse
    100402255 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100402255 (DDC)
   05031 Amphetamine addiction
    100402255 (DDC)
   05034 Alcoholism
    100402255 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100402255 (DDC)
Enzymes [BR:cjc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100402255 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     100402255 (DDC)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100402255 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100402255
NCBI-ProteinID: XP_002751460
Ensembl: ENSCJAG00000011007
UniProt: A0A2R8MA76
Position
8
AA seq 480 aa AA seqDB search
MNSSEFRRRGKEMVDYVANYLEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDI
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPEAFLAVKAGEGGGVIQGSASEATLMALLAARTKVIHRLQAESPELTQAAIM
ENLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRGSALQEALERDKAAGLIPFFVA
ATLGTTTCCSFDNLLEVGPICNKEDLWLHIDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRADLANAFRLDPTYLKHSHQDSGFITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICAEVTLGLVCFRLKGSNKVN
EALLQRINNAKKIHLVPCHLRDKFVLRFAICSRTVESVHVQVAWEHIKEMAADVLQAERK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgagtgaattccgcaggagagggaaggagatggtggattatgtggccaactac
ctggaaggcattgagggacgccaggtctaccctgatgtggagcctggctacctgcggccg
ctgatccctgctgctgccccccaggagccagacaccttcgaggacatcattaacgacatt
gagaagataatcatgccaggggtgacgcactggcacagcccctacttcttcgcctacttc
cccacagccagctcgtacccggccatgcttgcagacatgctgtgtggggccatcggctgt
attggcttctcctgggccgcaagcccagcatgtacagaactggagactgtgatgatggac
tggcttgggaagatgctggagctaccagaggcctttttggctgtgaaagccggagaaggg
ggaggagtgatccagggaagtgccagcgaagccaccctgatggccctgctggctgctcgg
accaaagtgatccatcggctacaggcagagtccccagagctgacacaggctgccatcatg
gagaacctggtggcttactcatctgatcaggcacactcctcagtggaaagagccgggtta
attggtggagtgaagttaaaagccatcccctcagatggcaactttgccatgcgtgggtct
gccctgcaggaagccctggagagagacaaggcggctggcctgattccattctttgtggct
gccaccctggggaccacaacgtgctgctcctttgacaatctcttggaagtaggtcctatc
tgcaacaaggaagacttgtggctgcacatcgatgcggcctatgcaggcagcgcgttcatc
tgccctgagttccggcaccttctgaatggagtggagtttgcagattcattcaactttaat
ccccacaaatggctgttggtgaattttgactgctctgccatgtgggtgaaaaagagagca
gacttagcaaatgcctttagactggatcccacttacctgaagcacagccatcaggattca
ggatttatcactgactaccggcactggcagataccactgggccgaagatttcgctctttg
aaaatgtggtttgtatttaggatgtacggggtcaaaggactgcaggcttatatccgcaag
cacgtccagctgtcccatgagtttgagtccctggtgcgccaggatccccgctttgaaatc
tgtgcggaagtcactctggggcttgtctgctttcggctaaagggttccaacaaagtgaat
gaagctcttctgcaaagaataaacaatgccaaaaaaatccacttggttccatgtcatctc
agggacaagtttgtcctgcgctttgccatctgctctcgcaccgtggaatctgttcacgtg
caggtggcctgggagcacatcaaagagatggcggccgacgttctgcaagcggagagaaag
tag

DBGET integrated database retrieval system