KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402266Help
Entry
100402266         CDS       T03264                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04210  Apoptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04926  Relaxin signaling pathway
cjc04931  Insulin resistance
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100402266 (NFKBIA)
   04668 TNF signaling pathway
    100402266 (NFKBIA)
   04024 cAMP signaling pathway
    100402266 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100402266 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100402266 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    100402266 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    100402266 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    100402266 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    100402266 (NFKBIA)
   04660 T cell receptor signaling pathway
    100402266 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    100402266 (NFKBIA)
   04659 Th17 cell differentiation
    100402266 (NFKBIA)
   04657 IL-17 signaling pathway
    100402266 (NFKBIA)
   04662 B cell receptor signaling pathway
    100402266 (NFKBIA)
   04062 Chemokine signaling pathway
    100402266 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100402266 (NFKBIA)
   04926 Relaxin signaling pathway
    100402266 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100402266 (NFKBIA)
  09158 Development
   04380 Osteoclast differentiation
    100402266 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100402266 (NFKBIA)
   05203 Viral carcinogenesis
    100402266 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100402266 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100402266 (NFKBIA)
   05215 Prostate cancer
    100402266 (NFKBIA)
   05222 Small cell lung cancer
    100402266 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100402266 (NFKBIA)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100402266 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100402266 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    100402266 (NFKBIA)
   05162 Measles
    100402266 (NFKBIA)
   05164 Influenza A
    100402266 (NFKBIA)
   05161 Hepatitis B
    100402266 (NFKBIA)
   05160 Hepatitis C
    100402266 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    100402266 (NFKBIA)
   05163 Human cytomegalovirus infection
    100402266 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100402266 (NFKBIA)
   05169 Epstein-Barr virus infection
    100402266 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100402266 (NFKBIA)
   05140 Leishmaniasis
    100402266 (NFKBIA)
   05142 Chagas disease (American trypanosomiasis)
    100402266 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100402266 (NFKBIA)
   04131 Membrane trafficking [BR:cjc04131]
    100402266 (NFKBIA)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100402266 (NFKBIA)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100402266 (NFKBIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Motif
Other DBs
NCBI-GeneID: 100402266
NCBI-ProteinID: XP_002753867
Ensembl: ENSCJAG00000006806
UniProt: U3EDW5
Position
10
AA seq 310 aa AA seqDB search
MFQAAEWAMEGLRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAQHGAE
PWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDVAFLNFQNNLQQTPLHLAVITNQP
EIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQACTTPHLHSILKATNYNGH
TCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVN
RVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDD
CVFAGQRLTL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggcagccgagtgggccatggagggcctccgcgatgggctgaagaaggagcgg
ctgctggacgaccgccacgacagcggcctggactctatgaaggacgaggagtacgagcag
atggtcaaggagctgcgggagatccgcctagagccgcaggaggcgcagcacggcgccgag
ccctggaagcagcagctcaccgaggacggggactcgttcctgcacttggccatcatccat
gaagaaaaggcacttaccatggaagtaatccgccaggtgaagggagacgtggccttcctc
aacttccagaacaacctgcagcagactccactacacttggctgtgatcaccaaccagcca
gaaattgctgaggcacttctgggagctggctgtgatcctgagctccgagactttcgagga
aatacccccctacaccttgcctgtgagcagggctgcctggccagcgtgggagtcctgact
caggcctgcaccaccccacacctccactccatcctgaaagctaccaactacaatggccac
acgtgtctgcacttagcttctatccatggctacctgggcatcgtggagcttttggtatcc
ttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcccttcacctcgca
gtggacctgcagaatcctgacttggtgtcgctcctgctgaagtgtggggctgatgtcaac
agagttacctaccagggctactccccttaccagcttacctggggtcgcccaagcacccgg
atacagcagcagctgggccagctgacactagaaaaccttcagatgctgccagagagtgag
gatgaggagagctatgacacagagtcagaattcacggaggatgagctcccctatgatgac
tgtgtgtttgcaggccagcgtctgacattatga

DBGET integrated database retrieval system