KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402341Help
Entry
100402341         CDS       T03264                                 

Gene name
XIAP, BIRC4
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04510  Focal adhesion
cjc04621  NOD-like receptor signaling pathway
cjc05145  Toxoplasmosis
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100402341 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100402341 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100402341 (XIAP)
   04215 Apoptosis - multiple species
    100402341 (XIAP)
   04217 Necroptosis
    100402341 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100402341 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100402341 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100402341 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100402341 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100402341 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100402341 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100402341 (XIAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100402341 (XIAP)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100402341 (XIAP)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100402341 (XIAP)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100402341 (XIAP)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100402341 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_UBOX DUF2039
Motif
Other DBs
NCBI-GeneID: 100402341
NCBI-ProteinID: XP_002763280
Ensembl: ENSCJAG00000020553
UniProt: B0KWH9
Position
X
AA seq 497 aa AA seqDB search
MTFNSFEGSKTCVPADINKDEEFVEEFNRLNTFANFPSSSLVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAIGRHRKVSPNCRFINGFYFENSATQPTNPGIQNGQYKVENY
LGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDPVSSDRNYPNSTNLPRNPSMADYEARIITFGTWIYSVNKEQLARAGFYALGDSDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYVNNIHLTHSLEECLVRTTEKTP
SLTRRIDETIFQNPMVQEAIRMGFSFKDIKKTMEEKIQISGSNYKSLEVLVADLVNAQKD
STQDESSQTSLQNEISTEEQLRRLQEEKLCKICMDRNIAVVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaggat
gaagaatttgtagaagagtttaatagattaaacacttttgctaattttccaagtagtagt
cttgtttcagcatcaacactggcaagagcagggtttctttatactggtgaaggagatacc
gtgcggtgctttagttgtcatgcagccgtagatagatggcaatatggagactcagcaatt
ggaagacacaggaaagtatccccaaattgcagatttatcaacggcttttattttgaaaat
agtgccacgcaacctacaaatcctggtatccagaatggtcagtacaaagttgaaaactat
ctgggaagcagaaatcattttgctttagacaggccatctgagacacatgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccgaggaaccctgccatg
tatagtgaagaagctagactgaagtcctttcagaactggccagactatgcccacctaacc
ccaagagagttagcgagtgctggactctactacacaggtattgatgaccaagtgcagtgc
ttttgttgtggaggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccgcaatcttaacatccgaagtgaa
tctgatcctgtgagttctgataggaattacccaaattcaacaaatcttccaagaaatcca
tccatggcagattatgaagcacggatcattacttttgggacgtggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgacagtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctaaatggtatccagggtgtaaatatctgttggaacaaaagggacaagaatatgtaaac
aatattcatttaacccattcacttgaggagtgtctggtaagaactactgagaaaacacca
tcactaactagaagaattgatgaaaccatcttccaaaatcctatggtccaagaagctata
cgaatggggttcagtttcaaggacattaagaaaacaatggaggaaaaaattcagatatct
gggagcaactataaatcacttgaggttctggttgcagatctagtgaatgctcagaaagac
agtacacaagatgaatcaagtcagacttcattacagaatgagattagtactgaagagcag
ctaaggcgcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtc
gtttttgttccttgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaaa
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system