KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402600Help
Entry
100402600         CDS       T03264                                 

Gene name
NOP58
Definition
(RefSeq) NOP58 ribonucleoprotein
  KO
K14565  nucleolar protein 58
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    100402600 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cjc03009]
    100402600 (NOP58)
Ribosome biogenesis [BR:cjc03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    100402600 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 100402600
NCBI-ProteinID: XP_002749695
Ensembl: ENSCJAG00000004985
UniProt: F7IB06
Position
6
AA seq 532 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSEFLPEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEQVNKEDDIPEKKAKKGKIKVKVEEEEEEEEEEVV
EEEETSVKKKKKKGKKKHIKEEPLSEEEPCTSTTIPSPEKKKKKKKKRDNED
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgttggttctgtttgaaacgtccgttggctacgccatctttaaggttctaaatgagaag
aaacttcaagaggttgatagtttatggaaagaatttgaaactccagagaaagccaacaaa
atagtaaagctaaaacattttgagaaatttcaggatacagcagaagcattagcagcattc
acagctctgatggagggcaaaatcaataagcagctcaagaaagttcttaagaaaatagta
aaagaagcccatgaaccgttggcagtggctgatgctaaactaggaggggtcataaaggaa
aagctgaatctcagttgtatccatagtcccgtcgttaatgaacttatgagaggaattcgt
tcacaaatggatggattaattcctggcgtagaaccacgtgaaatggcagctatgtgtctt
ggattggctcacagcctgtctcgatatagattgaaatttagcgctgataaagtagacaca
atgattgttcaggcaatttccttattagatgacttggataaagaactaaacaactacatt
atgcgatgtagagaatggtatggctggcatttccctgaattaggaaaaattatttcagat
aatttgacatactgcaagtgtttacagaaagttggcgataggaagaactatgcctctgcc
aaactttctgagttcctaccagaagaagttgaagcagaagtgaaagcagctgcggagata
tcaatgggaacagaggtttcagaagaagatatttgcaatattctgcatctttgcacccag
gtgattgaaatctctgaatatcgaacccagctctatgaatatctacaaaatcgaatgatg
gccattgcacccaatgttacagtcatggttggggaattagttggagcacggcttattgct
catgcaggttctcttttgaatttggccaagcatgcagcttctacagttcaaattcttgga
gcagaaaaggcacttttcagagccctcaaatctagacgggatacccctaagtatggtctc
atttatcatgcttcactcgtcggccagacaagtcccaagcacaaaggaaagatttctcga
atgctggcagccaaaactgttttggctatccgttatgatgctttcggtgaggattccagt
tctgcgatgggagttgagaacagagccaaattagaggccaggttgagaactttggaagat
agagggataagaaaaataagtggaacaggaaaggcattagcaaaaacagaaaaatatgaa
cacaaaagtgaagtgaagacttatgatccttctggtgactccacacttccaacttgttct
aaaaaacgcaaaatagaacaggtaaataaagaggatgatattcctgaaaagaaagcgaag
aaaggcaagattaaagttaaagttgaagaagaggaagaagaagaagaagaagaagtggta
gaagaagaagaaacatctgtgaagaagaagaagaaaaagggtaaaaagaagcacattaag
gaagaaccactttctgaggaagaaccatgtaccagcacaacaattcctagtccagagaaa
aagaagaaaaagaaaaaaaagagagataatgaggactaa

DBGET integrated database retrieval system