KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402685Help
Entry
100402685         CDS       T03264                                 

Gene name
ITGB2
Definition
(RefSeq) integrin subunit beta 2
  KO
K06464  integrin beta 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04390  Hippo signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04610  Complement and coagulation cascades
cjc04650  Natural killer cell mediated cytotoxicity
cjc04670  Leukocyte transendothelial migration
cjc04810  Regulation of actin cytoskeleton
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05144  Malaria
cjc05146  Amoebiasis
cjc05150  Staphylococcus aureus infection
cjc05152  Tuberculosis
cjc05166  Human T-cell leukemia virus 1 infection
cjc05323  Rheumatoid arthritis
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100402685 (ITGB2)
   04390 Hippo signaling pathway
    100402685 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100402685 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100402685 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100402685 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100402685 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    100402685 (ITGB2)
   04670 Leukocyte transendothelial migration
    100402685 (ITGB2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100402685 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100402685 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100402685 (ITGB2)
   05134 Legionellosis
    100402685 (ITGB2)
   05150 Staphylococcus aureus infection
    100402685 (ITGB2)
   05152 Tuberculosis
    100402685 (ITGB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100402685 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100402685 (ITGB2)
   05144 Malaria
    100402685 (ITGB2)
   05140 Leishmaniasis
    100402685 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100402685 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100402685 (ITGB2)
   04515 Cell adhesion molecules [BR:cjc04515]
    100402685 (ITGB2)
   04090 CD molecules [BR:cjc04090]
    100402685 (ITGB2)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100402685 (ITGB2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100402685 (ITGB2)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin beta subunits
   100402685 (ITGB2)
CD molecules [BR:cjc04090]
 Proteins
  100402685 (ITGB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 100402685
NCBI-ProteinID: XP_017822669
Ensembl: ENSCJAG00000010554
Position
21
AA seq 783 aa AA seqDB search
MSPTAASATIRSQDMLGLRPQLLALVGLLFLGCVLSQECTKFKVSTCQDCIESGPSCAWC
QKLNFTGPGDPDSVRCDTRAQLLMKGCAADDIMDPRSFAETLEDRDGGRKQLFPQKVTLY
LRPGQEAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLMNVKKLGGDLLQALNEITESGRI
GFGSFVDKTVLPFVNTHPEKLRNPCPNKEKECQAPFAFRHVLKLTNNSNQFQTEVGKQLI
SGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRC
HLEDNMYKSSNEFDYPSVGQLAHKLAESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELS
EDSSNVVQLIKNAYNKLSSRVFLEHNALPDTLKVTYDSICSNGVIHRNQPRGDCDHVQIN
VPITFQVKVTATECIPEHSFVIRALGFTDTVTVRVLPQCECRCRDQSKDRSLCRGKGSLE
CGICRCDAGYIGKNCECQTQGRSSQELEGSCRKDNSSLVCSGLGDCICGQCLCHTSDVPG
KQIYGQFCECNTISCERHNGQVCGGPGRGVCFCGQCRCLPGFEGSACQCERTTQGCLNQN
QVECSGRGRCLCNVCVCEGSYQPPLCQECPVCSSPCGEYISCAECLKFDKGPFGKNCSVA
CSGLQLRDKPVKGKACKERDSEGCWVSYMLEQQDGMKRYLIYVDESRECVAGPNIAAIVG
GTVAGIVLIGVLLLVIWKALTHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKF
AES
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaacagcagcctcagcaacgatccggtcacaggacatgctgggcctgcgcccc
caactactcgccctggtagggctgctcttcctggggtgtgtcctctctcaggagtgcacc
aagttcaaggtcagcacctgccaagactgcatcgagtcagggcccagctgcgcctggtgc
cagaagctgaacttcaccgggccaggggatcctgactccgttcgctgcgacacccgagcg
cagctgctcatgaagggctgtgcggccgatgacatcatggaccccaggagctttgctgaa
accctggaagaccgtgatgggggccggaagcagctgtttccacaaaaagtgacgctttac
ctgcgaccaggccaggaagcagcattcaatgtgaccttccggcgagccaagggctacccc
atcgacctgtactacctgatggacctctcctactccatgctcgatgacctcatgaacgtc
aagaagctgggcggtgacctgctccaggccctcaatgagatcacagagtctggccgcatc
ggctttgggtcctttgtggacaagaccgtgctgccgttcgtgaacacacaccccgagaag
ctgcggaacccctgccccaacaaggagaaagagtgccaggccccgtttgccttcaggcac
gtgctgaagctgaccaacaactccaaccagtttcagacagaggtcgggaagcagctgatt
tcaggaaacctggatgcgcctgagggcgggctggacgccatgatgcaggtcgccgcctgc
ccggaggaaattggctggcgcaacgtcacgcggctgttggtgttcgccaccgacgacggc
ttccactttgccggcgatgggaagcttggcgccatcctgacccccaacgatggccgctgt
cacctggaggacaacatgtacaagagcagcaacgagtttgactacccatcggtgggccag
ctggcacacaagctggccgaaagcaacatccagcccatcttcgcggtgaccaagaagatg
gtgaagacctacgagaaactcacggagatcatccccaagtcagctgtgggggagctgtct
gaggactccagcaacgtggttcagctcattaagaacgcctacaacaaactctcctcaagg
gtcttcctggaacacaacgccctccctgacaccctgaaagtcacctatgactccatctgc
agcaatggagtgatacacaggaaccagcccagaggggactgcgaccatgtgcagatcaac
gtcccgatcaccttccaggtgaaggtcacggccacagagtgcatcccagagcactcattt
gtcatccgggcactgggcttcacggacacagtgaccgtgcgagtccttccccagtgcgag
tgccggtgccgggaccagagcaaggatcgaagcctctgccgtggcaagggctccttggag
tgtggcatctgcaggtgtgacgctggttacattgggaaaaactgtgagtgccagacgcag
ggccggagcagccaggagctggagggaagctgccggaaggacaacagctcgctggtgtgc
tcagggctgggggactgcatctgcgggcagtgcctgtgccacaccagcgacgtccccggc
aagcagatctacgggcagttctgcgagtgcaacacaatcagctgtgagcgccacaatggc
caggtctgcggcggcccagggaggggggtctgcttctgtggccagtgccgctgcctcccg
ggcttcgagggctcagcctgccagtgcgagaggaccacccagggctgcctgaaccagaac
caggtggagtgtagcggccgtggccggtgcctttgcaacgtgtgtgtgtgcgagggaagc
taccagccccctctgtgccaggagtgccccgtctgctcctcgccctgtggcgaatacatc
tcctgcgccgagtgcctgaagttcgacaagggcccgttcgggaagaactgcagtgtggcg
tgctcaggcctgcagctgcgggacaagccggtgaagggcaaggcctgcaaggagagggac
tcggagggctgctgggttagctacatgctggagcagcaggacgggatgaaacgttacctc
atctacgtggacgagagccgagaatgcgtggcgggccccaatatcgccgccattgtcggg
ggcactgtggcgggcattgtgctcattggcgtcctcctgctggtcatctggaaggctttg
acccacctgagtgacctccgggagtacaggcgctttgagaaggagaagctcaagtcccag
tggaacaacgataatccgcttttcaagagtgccaccacaacagtcatgaacccgaagttt
gctgagagttag

DBGET integrated database retrieval system