KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402880Help
Entry
100402880         CDS       T03264                                 

Gene name
CXCL12
Definition
(RefSeq) C-X-C motif chemokine ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04360  Axon guidance
cjc04670  Leukocyte transendothelial migration
cjc04672  Intestinal immune network for IgA production
cjc04810  Regulation of actin cytoskeleton
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100402880 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100402880 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100402880 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100402880 (CXCL12)
   04672 Intestinal immune network for IgA production
    100402880 (CXCL12)
   04062 Chemokine signaling pathway
    100402880 (CXCL12)
  09158 Development
   04360 Axon guidance
    100402880 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100402880 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100402880 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100402880 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100402880 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100402880 (CXCL12)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100402880 (CXCL12)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Chemokines
   100402880 (CXCL12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100402880
NCBI-ProteinID: XP_009007767
Ensembl: ENSCJAG00000016304
Position
12
AA seq 111 aa AA seqDB search
MNAKVLVVLALVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQPQC
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggtcttggtcgtactggccctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattctttgaaagccatgttgcc
agagccaatgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgtg
gcacggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaaggggcgcagagaagaaaaagtggggaaaaaagaa
aagataggaaaaaagaagcgacagccccaatgttga

DBGET integrated database retrieval system