KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402957Help
Entry
100402957         CDS       T03264                                 

Gene name
FAN1
Definition
(RefSeq) FANCD2 and FANCI associated nuclease 1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100402957 (FAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100402957 (FAN1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     100402957 (FAN1)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     100402957 (FAN1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     100402957 (FAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC zf-TRAF zf-WRNIP1_ubi DUF4363
Motif
Other DBs
NCBI-GeneID: 100402957
NCBI-ProteinID: XP_017828737
Ensembl: ENSCJAG00000017520
Position
6
AA seq 1050 aa AA seqDB search
MMSEGKPSDRKKPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCRKMVPRYDLNRHL
DEMCANNDVVQVDPGQVGIINSNVSTVDVTSAALEDVMPEKSPPPKANLTAGQSDSAKMA
VKHKSSPYFKSNDALVCTNQDELRNRSVKVISLGSLASKLSRKYTRAKKSIDKDEEFAGS
SPQSSRSTVIQSLVDNSSEIEDKDQILENSSQKENMFLCDSLKEECIPEHMVRGNKIMEA
ESQKATQECEKSALTPGFSDNALMLFSPDFTLGNTLKSTSDDSLVKQESITGVVGQREAC
SCEEVKMTVASEAKIQLSDSEAKSQSSADDVSACSNIQEAPRQGDSGLSSDISRSIPLDQ
GSSCDGPDQTTSHPYYLRSFLVVLKTVLENEDDMMLFDEQEKGIITKFHQLSGTGQKLYV
RLFQRKLSWIKMSKLEYKEIASDLTPVIEELQHAGFLQTESQLQELSEVLELLSAPELKS
LAKTFHLLNPSGQKQQLVDSFLKLAKQRSVCTWGKNTPGIGAVILKRAKALAGQSVRICK
GPRAVFSRILLLFSLTDSTEDEDAACGGQGQLSTVLLVNLGRMEFPSYTINRKTQIFQDR
DDLIRYAAAVHMLSDISSAMANGNWEEAKELAQCAKRDWDRLKNHPSLRWHAELPVFLRC
FTVGWIYTKILCRSVEILQRLHMYEGQPAGTQVKSRDASRNSRPLQKEAVRELESLLSQR
IYCPDSRGRWWDRLALNLHQHLKRLEPAIKCITEGLADPEVRTGHRLSLYQRAVRLRESP
SCKKYKHLLQQLPEMAVQDVKHVTITGRLCPQHGMGKSVFVMEAGETADPTTVLCSVEEL
ALAHYRRNGFDQGIHGEGSTFSTLYGLLLWDIIFMDGIPDVFRNACQAFPLDLCTDSFFT
SRGPALEARLQLIHDAPVESLRAWVAATWQDQEGRVASLVSWDRFTSLEQAQDLVSCLGG
RVLSGVCRRLAADFRHCRGGLPDLVVWNTPSHRCKDSFYCLLLVCSGQHTIAAIMKMTCT
YFYVMNAMKEMLREDLLRAVTSQDEFKLSI
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagaagggaaaccttctgacagaaaaaagcctcgtagaagcttatcaatcagc
aagaataagaaaaaagcatctaattctattatttcgtgttttaacaatgcaccaccagcc
aaacttgcctgccccgtttgccgtaaaatggtgcctagatatgacttaaaccggcacctt
gatgaaatgtgtgctaacaatgacgtcgttcaagttgacccagggcaagttggcataata
aattctaatgtgtctacggtagatgtaaccagtgctgctttagaagatgtaatgccagag
aagtcaccaccaccaaaggcaaatttaactgctggccaaagtgattcagcaaaaatggcc
gtaaaacacaagtccagtccctactttaaaagtaatgatgccttggtgtgtacaaatcaa
gatgagctgagaaatcgtagtgtgaaagtcatttctttgggaagcctagcatctaaattg
tccagaaaatacacaagggctaaaaaatcaatagataaggatgaagaatttgccggttct
agtccacagagttccagatccacggtcattcagagcctggttgataactcttcagaaatt
gaggacaaggatcaaattttggagaacagttctcaaaaagaaaacatgtttctatgtgat
tctctaaaggaagagtgtattcccgaacacatggtaagaggaaataaaataatggaagct
gaaagccaaaaggctacccaggaatgtgagaaatcagccctcacccctggcttctcagat
aatgcgctcatgttattttcaccagatttcactcttgggaatacattaaagtctacgtca
gacgacagtcttgtaaagcaagagtctatcacaggagtggttggacaacgtgaagcatgt
agttgtgaagaagtaaaaatgactgttgcctcagaagctaaaatacagctgtcagattca
gaggcaaaatctcagagttctgcagatgatgtttccgcatgtagtaacatccaagaggct
cctcggcagggtgacagtggcttaagcagtgatatctctcgtagcattcctttggaccag
gggtcaagctgcgatggtcctgatcaaacaaccagtcatccttactaccttcgaagtttc
cttgtggtgctgaaaaccgtacttgagaatgaagatgatatgatgctctttgatgagcag
gagaagggaattataactaaattccatcagttatcaggtactggtcagaagttatacgta
aggctctttcaacgtaaattaagctggattaagatgagtaaattagaatacaaggagatt
gcctcagacttaacacctgtgattgaagaattgcagcatgcaggctttctacagacagaa
tctcagttgcaagaactctctgaagtgcttgaactcctttctgctcctgaactgaaatcc
ctggccaagaccttccacttgctgaatcccagtggacagaaacagcagctggtggacagc
tttctcaaattggccaaacagcgttcagtctgcacttggggcaagaatacgcctggaatt
ggtgcagtgattttaaaaagagctaaagccttggctgggcagtcagtacgaatctgtaaa
ggccccagggctgtgttttcccggatcttgctgctgttttcattgaccgactccacggag
gatgaagatgctgcttgtggaggtcaggggcagctttcaacggtcctgttggtcaacctt
ggccgaatggagtttcctagttacaccatcaatcggaaaacccaaatcttccaagacaga
gatgatcttattagatatgcagcagccgtgcacatgctgagtgacatttcttctgcaatg
gccaacgggaactgggaagaagctaaggagctcgctcagtgtgcaaaacgggattgggac
agactgaaaaaccacccttctctgagatggcacgcagagttaccagtctttctgcggtgt
ttcactgttggatggatttatacaaagattttgtgtcggtccgtggaaatcctgcagaga
cttcacatgtatgagggccagccggcagggacccaggtgaaaagtagggatgcctcaagg
aactcacgcccactccagaaggaagccgtcagggaacttgaaagccttttgtctcagaga
atttattgtcctgacagcagaggccgatggtgggatcgactggctcttaacctacaccag
cacttgaagcgcctggaaccggctatcaagtgcatcacagaggggctggcagatccggaa
gtcagaacaggacaccgcctttccctgtatcagcgagccgtgcgcctgcgagagtctccg
agctgtaaaaagtacaaacacctcttgcagcagctcccagaaatggctgtgcaagatgtg
aaacacgtgaccatcacgggcaggctgtgcccacagcatgggatgggcaagtctgtgttt
gtgatggaggccggggagactgctgaccccaccacagtcctgtgttccgtggaggagctg
gcactggcccattacagacgcaacggctttgaccaggggattcatggtgaaggctctacc
ttcagcaccctgtatggcctcctcctgtgggacatcatcttcatggacgggattccggat
gtcttcagaaatgcctgtcaggctttccccctggacttgtgcacagacagcttcttcaca
agcagaggcccggcccttgaggccaggctgcagctgattcacgatgcccccgtggagagc
ctgcgcgcctgggtggcagccacgtggcaggaccaggaaggcagagtggcttcccttgtc
agctgggatcgcttcacgtctcttgagcaagctcaggatctcgtctcctgcctggggggc
cgtgtgctcagtggtgtgtgccggcgcctggctgctgactttcgacattgccgagggggc
ctccctgacctggtggtgtggaacaccccgagccatcgctgtaaggatagtttttattgt
cttctactagtgtgcagtggacaacacacaattgctgccattatgaagatgacatgtaca
tatttttatgttatgaacgccatgaaagaaatgcttagggaggatctacttagagctgtg
acctctcaagatgagtttaagctgagcatttaa

DBGET integrated database retrieval system