KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403006Help
Entry
100403006         CDS       T03264                                 

Gene name
GNAQ
Definition
(RefSeq) G protein subunit alpha q
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100403006 (GNAQ)
   04371 Apelin signaling pathway
    100403006 (GNAQ)
   04020 Calcium signaling pathway
    100403006 (GNAQ)
   04071 Sphingolipid signaling pathway
    100403006 (GNAQ)
   04022 cGMP-PKG signaling pathway
    100403006 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100403006 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100403006 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    100403006 (GNAQ)
   04922 Glucagon signaling pathway
    100403006 (GNAQ)
   04912 GnRH signaling pathway
    100403006 (GNAQ)
   04915 Estrogen signaling pathway
    100403006 (GNAQ)
   04921 Oxytocin signaling pathway
    100403006 (GNAQ)
   04918 Thyroid hormone synthesis
    100403006 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    100403006 (GNAQ)
   04916 Melanogenesis
    100403006 (GNAQ)
   04924 Renin secretion
    100403006 (GNAQ)
   04925 Aldosterone synthesis and secretion
    100403006 (GNAQ)
   04927 Cortisol synthesis and secretion
    100403006 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100403006 (GNAQ)
   04270 Vascular smooth muscle contraction
    100403006 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    100403006 (GNAQ)
   04971 Gastric acid secretion
    100403006 (GNAQ)
   04972 Pancreatic secretion
    100403006 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100403006 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    100403006 (GNAQ)
   04725 Cholinergic synapse
    100403006 (GNAQ)
   04728 Dopaminergic synapse
    100403006 (GNAQ)
   04726 Serotonergic synapse
    100403006 (GNAQ)
   04720 Long-term potentiation
    100403006 (GNAQ)
   04730 Long-term depression
    100403006 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    100403006 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100403006 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100403006 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403006 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100403006 (GNAQ)
   05016 Huntington disease
    100403006 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100403006 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100403006 (GNAQ)
   05163 Human cytomegalovirus infection
    100403006 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100403006 (GNAQ)
   05142 Chagas disease (American trypanosomiasis)
    100403006 (GNAQ)
   05143 African trypanosomiasis
    100403006 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100403006 (GNAQ)
   04031 GTP-binding proteins [BR:cjc04031]
    100403006 (GNAQ)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100403006 (GNAQ)
GTP-binding proteins [BR:cjc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100403006 (GNAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 100403006
NCBI-ProteinID: XP_002742862
Ensembl: ENSCJAG00000003268
UniProt: F7IC22
Position
1
AA seq 359 aa AA seqDB search
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagtgaggaggccaaggaagcccggagg
atcaacgatgagatcgagcggcagctccgcagggacaaacgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactccgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggctatgcaggccatgatcagagccatggacacactcaagatcccg
tacaagtatgagcataataaggctcatgcccaattagttcgagaagttgatgtggagaag
gtatctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgacagacgacgagaatatcagttatctgactctaccaaatactat
cttaatgacttggaccgtgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctctttagaacaattatcaca
tatccctggttccagaactcctcggtgattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagttgactacttcccagaatatgatggaccccagaga
gatgcccaggccgcccgagaatttatcctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacgtgcgccacagacaccgagaacatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system