KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403175Help
Entry
100403175         CDS       T03264                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04140  Autophagy - animal
cjc04152  AMPK signaling pathway
cjc04310  Wnt signaling pathway
cjc04380  Osteoclast differentiation
cjc04520  Adherens junction
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00686  Toll-like receptor signaling
cjc_M00688  MAPK (JNK) signaling
cjc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100403175 (MAP3K7)
   04310 Wnt signaling pathway
    100403175 (MAP3K7)
   04064 NF-kappa B signaling pathway
    100403175 (MAP3K7)
   04668 TNF signaling pathway
    100403175 (MAP3K7)
   04152 AMPK signaling pathway
    100403175 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100403175 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100403175 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100403175 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    100403175 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    100403175 (MAP3K7)
   04660 T cell receptor signaling pathway
    100403175 (MAP3K7)
   04657 IL-17 signaling pathway
    100403175 (MAP3K7)
  09158 Development
   04380 Osteoclast differentiation
    100403175 (MAP3K7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100403175 (MAP3K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100403175 (MAP3K7)
   05162 Measles
    100403175 (MAP3K7)
   05161 Hepatitis B
    100403175 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    100403175 (MAP3K7)
   05169 Epstein-Barr virus infection
    100403175 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100403175 (MAP3K7)
   05140 Leishmaniasis
    100403175 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100403175 (MAP3K7)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100403175 (MAP3K7)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: TKL group
  MLK family
   100403175 (MAP3K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 100403175
NCBI-ProteinID: XP_008993055
Position
4
AA seq 797 aa AA seqDB search
MARLGHPRLAREELEREGERREGGCFSPHGSSDASRASPQLPRLRLGLGRRERHPDHRCP
EGRSHRGFFVTVSRTPGTEIHARAGGTSAHDLRAEWGAETGAQISNYSSWSSSLRPASCF
RFQPGTGSIVGGARQRKTQRSQSRDTAVAAAPTPATDRRVVGVRGSRLMSVRSGWARVSP
GLSGRHRSRATLAPRGIMSTGSAASSSPRLRRPFRSLNFEEIDYKEIEVEEVVGRGAFGV
VCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEG
GSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGT
VLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPF
DEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMR
YFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLE
SKLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPK
RGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSG
PTPEKPTRNHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKM
AQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCK
KQLEVIRSQQQKRQGTS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggctgggacacccgcgcctggcgcgagaagagctggagcgagaaggggagcgg
agggaagggggttgcttctcccctcatgggagctcggacgcctcgcgggcctcgccccag
cttcccagactccggctgggattgggacgccgagagaggcatcccgaccaccgctgccct
gagggcaggagccaccgtggcttctttgtcaccgtgtcccggacaccaggcacagaaatc
cacgcgagggctggaggaacgtcagcccacgacctacgagccgagtggggagccgagacc
ggagcccagatttctaactactcctcgtggtcctcgagtttacggcccgcctcctgtttc
cgatttcagcccggaaccggaagtatagtgggcggggcccggcagcggaaaacgcagcgg
agccagagccgggacacggctgtggccgctgcccctacacccgccacggaccgacgggtg
gtaggagtgcgcggctccaggctgatgtcggtccggagcgggtgggcgcgggtctcaccc
ggactgtccgggcggcaccgttcccgggccaccctggcgccgcgagggatcatgtctaca
ggctcagccgcctcctcctctcctcgtcttcgccgccctttcaggtccctcaactttgaa
gagatagactacaaggaaatcgaggtggaagaggttgttggaagaggagcctttggagtt
gtttgcaaagcaaagtggagagcaaaagatgttgctattaaacaaatagaaagtgaatct
gagaggaaagcttttattgtagagcttcggcagttatcccgtgtgaaccatcctaatatt
gtaaagctttatggagcctgcttgaatccggtgtgtcttgtgatggagtatgctgaaggg
ggctcgttatataatgtgctgcatggtgctgaaccattgccatattatactgctgcccac
gcaatgagttggtgtttacagtgttcccaaggagtggcttatcttcacagcatgcaacct
aaagcgctaattcacagggacctgaaaccaccaaacttactgctggttgcaggggggaca
gttctaaaaatttgtgattttggtacagcctgtgacattcagacacacatgaccaataac
aaggggagtgctgcttggatggcacctgaagtttttgaaggtagtaattacagtgaaaaa
tgtgacgtcttcagctggggtattattctttgggaagtgataacgcgtcggaaacccttt
gatgagattggtggcccagctttccgaatcatgtgggctgttcataacggtactcgacca
ccactgatcaaaaatttacctaagcccattgagagcctgatgactcgttgttggtctaaa
gatccttcccagcgcccttcaatggaggaaattgtgaaaataatgactcacttgatgcgg
tactttccaggagcagatgagccattacagtatccttgtcagtattcagatgaaggacag
agcaactctgccaccagtacaggctcattcatggacattgcttctacaaatacaagtaat
aaaagtgacactaatatggagcaagttcctgccacaaatgatactattaagcgcttagaa
tcaaaattgttgaaaaatcaggcaaaacaacagagtgaatctggacgtttaagcttggga
gcctcccgtgggagcagcgtggagagcttgcctccaacctctgagggcaagaggatgagt
gctgacatgtctgaaatagaagctaggattgctgcaaccacagcctattccaagcctaaa
cggggccaccgtaaaacagcttcatttggcaacattctggatgtccctgagatcgtcata
tcaggcaacggacagccaagacgtagatccatccaagacttgactgtaactggaacagaa
cctggtcaggtgagcagtaggtcatccagtcccagtgtcagaatgatcactacctcagga
ccaaccccagaaaagcctactagaaatcatccatggacccctgatgattccacagatacc
aatggatcagataactccatcccaatggcttatctcacactggatcaccaactacagcct
ctagcaccgtgcccaaactccaaagaatctatggcagtgtttgaacagcattgtaaaatg
gcacaagaatatatgaaagttcaaacagaaattgcattgttattacagagaaagcaagaa
ctcgttgcagaactggaccaggatgaaaaggaccagcaaaatacatctcgcctggtacag
gaacataaaaagcttttagatgaaaacaaaagcctttctacttactaccagcaatgcaaa
aaacaactagaggtcatcagaagtcagcagcagaaacgacaaggcacttcatga

DBGET integrated database retrieval system