KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403192Help
Entry
100403192         CDS       T03264                                 

Gene name
NOS2, iNOS
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00220  Arginine biosynthesis
cjc00330  Arginine and proline metabolism
cjc01100  Metabolic pathways
cjc04020  Calcium signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04146  Peroxisome
cjc04371  Apelin signaling pathway
cjc04926  Relaxin signaling pathway
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100403192 (NOS2)
   00330 Arginine and proline metabolism
    100403192 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100403192 (NOS2)
   04066 HIF-1 signaling pathway
    100403192 (NOS2)
   04020 Calcium signaling pathway
    100403192 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100403192 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100403192 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403192 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100403192 (NOS2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100403192 (NOS2)
   05133 Pertussis
    100403192 (NOS2)
   05152 Tuberculosis
    100403192 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100403192 (NOS2)
   05145 Toxoplasmosis
    100403192 (NOS2)
   05140 Leishmaniasis
    100403192 (NOS2)
   05142 Chagas disease (American trypanosomiasis)
    100403192 (NOS2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100403192 (NOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 100403192
NCBI-ProteinID: XP_017828071
Ensembl: ENSCJAG00000012477
Position
5
AA seq 1153 aa AA seqDB search
MACPWRFLFKAKFHQDVMTEGKDINNNVGKAPYATSSLVAQDDPLRHSLSKLQNESPQPF
MGTGKKSPESLVKLDATLSSCPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEVKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHLRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRARGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHDWQDKKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVLCMDKYRLSCLEEERLLLVVTSTFGNGDCPS
NGEKLKKSLFTLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIRIPKLYTSNVTWDPHHYRLVQDSQSLDL
SKALSNMHSKNVFTMRLKSRQNLQSQKSSRATXLVKLSCEDGQSLNYLPGEHLGVCPGNQ
PALVQGILERVVDGLEPHQTVRLEALDESGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATETAERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSVSSSWDHTPTEIHLTVAVVTYHTQDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRSASGFQLPEDPAHPCILVGPGTGIAPFRSFWQQRLHDSQHKGVQGGRMTLVFGCRRPD
EDHIYLEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMARDVAHTLKQLVAAKLDLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDR
AAVQPSSLEMSAL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtccttggaggtttctgttcaaggccaaattccaccaagatgtaatgacggag
ggaaaagacatcaacaacaatgtgggcaaagccccctatgccacctccagtctggtggca
caggatgaccccctgcgtcacagcctcagcaagctgcagaatgagtccccacagcccttc
atggggacaggaaagaagtctccagaatccctggtcaagctggatgcaaccctatcgtcc
tgcccacggcacgtgaggatcaaaaactggggtagcgggatgactttccaagacacactt
caccacaaggccaaagggattttgacttgcaggtctaaatcttgcctggggtctattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagacgagctccta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggtaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccgcgctgc
atcgggaggatccagtggtccaacctgcaggtcttcgacgcccgcagctgttccaccgcc
cgggagatgtttgaacacatctgtagacacctgcgttactccaccaacaacggcaacatc
aggtcggccattaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtgg
aacgctcagctcatccgctacgccggctaccagatgcccgatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtgcccctggtcctgcaggccaatggccgagaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaagtacgagtggtttcgg
gagctggagctaaagtggtatgccctgcctgcagtggccaacatgctacttgaggtgggc
ggcctggagttcccggggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcttcgctctggaaagaccaggctgttgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcagctgca
gaatccttcatgaagtacatgcagaatgaataccgggcccgcgggggctgcccggccgac
tggatttggctggtccctcccatatctgggagtatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttttactattatcaggtagaggcctggaaaacccatgac
tggcaggacaagaagcggagacccaagagaagagagattccgctgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacgatggcgtcccgagtcagagtcacc
atcctttttgcgacagagacgggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgcctttaaccccaaggttctctgcatggacaagtacaggctgagctgcctg
gaggaggagcggctgctgctggtggtgaccagcacgttcgggaacggagattgccccagc
aacggagagaaactaaagaaatccctcttcacactgaaagagctcaccaacaaattcagg
tacgcggtgtttggcctcggctccagcatgtaccctcagttctgtgcgtttgctcatgac
attgaccagaagctgtcccacctgggggcctctcagctcaccccaacgggagaaggggat
gagctcagtgggcaggaggatgccttccgcagctgggcagtgcaaaccttcaaggcggcc
tgcgagacatttgatgtccgaggcaaacagcacattcggatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggcttgtgcaggactcacagtctttggacctc
agcaaagccctcagcaacatgcactccaagaatgtgttcaccatgaggctgaaatctcgg
cagaatctacagagtcagaaatccagccgtgccaccnatctagtgaaactctcctgtgag
gatggccaaagtctgaactacctgccaggggagcacctcggggtttgcccaggcaaccag
ccagccctggttcaaggcatcctggagcgagtggtggacggccttgagccccaccagaca
gtgcgcctggaggccctggatgagagtggcagctactgggtcagagacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacccccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaaacagctgagagacagaggctggag
gccctgtgccagccctcagagtacagcaagtggaagttcaccaacagccccacattcctg
gaggtgctggaggagttcccatccttgcgggtgtctgctggcttcctgctctcccagctc
cccattctgaagccccggttctactctgtcagctcctcctgggatcacacacccaccgag
atccacctgactgtggccgtggtcacataccacacccaagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgcttt
gtgcgaagtgccagcggcttccagctccctgaggaccccgcccatccttgcatcctggtc
gggcctggcacaggcattgccccgttccgcagtttctggcagcagcggctccacgactcc
cagcacaagggagtgcagggagggcgcatgaccctggtgttcggatgccgccgcccagat
gaggaccacatctacctggaggaaatgctggagatggcccagaagggagtgctgcacgcg
gtgcacacagcctattcccgcctgccgggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccatgaggagccagggcacctctat
gtttgtggggatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagctggacttgaatgaggagcaggttgaggactatttctttcagctcaagagtcag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggtgaagaaggacagg
gcggcggtgcagcccagtagcctggagatgtctgcgctctga

DBGET integrated database retrieval system