KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403269Help
Entry
100403269         CDS       T03264                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03460  Fanconi anemia pathway
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100403269 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403269 (POLK)
   05202 Transcriptional misregulation in cancer
    100403269 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100403269 (POLK)
   05212 Pancreatic cancer
    100403269 (POLK)
   05225 Hepatocellular carcinoma
    100403269 (POLK)
   05226 Gastric cancer
    100403269 (POLK)
   05214 Glioma
    100403269 (POLK)
   05216 Thyroid cancer
    100403269 (POLK)
   05220 Chronic myeloid leukemia
    100403269 (POLK)
   05217 Basal cell carcinoma
    100403269 (POLK)
   05218 Melanoma
    100403269 (POLK)
   05213 Endometrial cancer
    100403269 (POLK)
   05224 Breast cancer
    100403269 (POLK)
   05222 Small cell lung cancer
    100403269 (POLK)
   05223 Non-small cell lung cancer
    100403269 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100403269 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100403269 (POLK)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100403269 (POLK)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100403269 (POLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 100403269
NCBI-ProteinID: XP_008990169
Ensembl: ENSCJAG00000017052
Position
2
AA seq 861 aa AA seqDB search
MDDTKEKNDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSKFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLNNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSVSMLTTSNYYARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGNSVENDNPGKEVNK
LSEHERSISPLLFEESPPDLQPPGDEEQNNPQILQNSVVFGTSAEEVVKEIRFRIEQKTT
LTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLK
ALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEIN
KAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFA
IAKELLKTEIDADFPHPLRLRLMGVRISSFPSEEDRKHQQRSIIGFLQAGNQTPSVNGCI
LEKTNKDKFAKPLKVSHKKSFFDKKRSERKWSHQDTFKCETVNEQSLQTSQPFPVLKKMN
ENSEISENSDNCQIFTCPVCFRAQGYISLEAFNKHVDACLDGPSISENSKMFSCSHVSAT
KVNKKENVSSSLYEKQDDEAHPKNREISPVDYVDLVDTIDNSSEAESIDALSNEHSKEEC
SSLPSKSFNIEHCHQNSCTVSLESEDVGLSRQESCQPYLCKVVTGQTLVCPVCNREQKTS
DLTLFNVHVDVCLNKSVIQELRRDKVNPVYQPKESSRSTGSSSGVQKTVTRTKRPGLMTK
YSTSKKIKPNNPKHTLDTFFK
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggatgacacaaaggagaagaatgacagttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacaaaggggtccaaattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgaaatttgaac
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgccgtaggatcagtgagtatgctgactacttcaaat
tactatgcaaggaggtttggtgttcgtgcagctatgccaggatttattgctaagagactc
tgcccacaacttataatagtgcccccaaactttgacaaataccgagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaacataacaaagcacttagaagaaagacaaaattggcctgaggataaaagaagg
tatttcatcaaaatgggaaactctgtagaaaatgataatccaggaaaggaagttaataaa
ctgagtgagcatgaacgatccatctctccgctactttttgaagagagtcctcctgatttg
cagccaccaggagatgaagaacaaaacaatcctcaaatactccaaaactcagttgttttt
ggaacatcagccgaggaagtggtaaaggagattcgtttcagaatcgagcaaaaaacaaca
ctgacagccagtgcaggcattgccccaaatacaatgttagcaaaagtgtgcagtgataag
aataaaccaaatggacaataccaaattctccccaatagacaagctgtgatggacttcatc
aaggatttacccattagaaaggtttctggaataggaaaagttacagaaaaaatgttaaag
gcccttggaattattacatgcacagaactttaccaacagagggcattgctttctctcctt
ttctctgaaacatcctggcattatttccttcacatctctttgggtctaggctcaacacac
ctaacaagagatggagaaaggaagagtatgagcgttgaaaggactttcagtgagataaat
aaagcagaagaacaatacagcctatgccaagaactttgcagtgaacttgctcaagatcta
cagaaagaaggtcttaagggtagaacggttaccattaagttgaagaatgtgaattttgaa
gtaaaaactcgtgcgtctacagtttcatctgttgtttctactgcagaagaaatatttgcc
attgctaaggagttgctaaaaacagaaattgatgctgattttccacatcccttaagatta
agacttatgggtgttcggatatctagttttcccagtgaagaagacaggaaacaccaacaa
aggagcattattggctttttacaggctggaaaccaaaccccatcagtcaatgggtgtata
ctagagaaaactaacaaagataagtttgcaaaacctctaaaagtgtctcataagaagagt
ttctttgataaaaaacgatcagaaaggaaatggagccaccaagatacatttaaatgtgaa
accgtgaatgaacaaagtttacagacatcacaaccattcccagttttaaagaagatgaat
gagaattcggaaatatcagagaattcagataactgtcagatatttacctgtcctgtttgc
tttagggcacaaggatacatcagtctggaagcctttaataaacatgtagatgcatgtctt
gatggaccttcaatcagtgaaaactctaaaatgttctcatgttcacatgtttctgcaacc
aaagttaacaagaaagaaaatgtttcttcttcactttatgagaagcaagatgatgaagcc
catccaaaaaatagagaaatatctccagtagattatgtagatttagtagatactatagat
aactcatctgaagcagaaagcatagatgctttaagtaatgagcatagcaaggaagaatgt
tctagtctcccaagcaagtcttttaatattgaacactgtcatcagaattcttgtactgtt
tcattggaaagtgaagatgttggattaagtagacaagaatcctgccagccttatttatgt
aaagtggtaacaggccaaacactagtttgtcctgtttgtaacagagaacaaaagacttca
gatctaaccctgttcaatgtgcatgtggatgtttgcttaaataaaagtgttatccaagaa
ctaagaagggataaagttaacccagtttatcaacccaaagaaagctccagaagtactggt
agctcaagtggagtacagaagactgtaacaagaacaaaaaggccaggattgatgacaaag
tactcaacatcaaagaaaataaaaccaaacaatcccaaacatacccttgatacatttttt
aagtaa

DBGET integrated database retrieval system