KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403307Help
Entry
100403307         CDS       T03264                                 

Gene name
SLC4A1
Definition
(RefSeq) solute carrier family 4 member 1 (Diego blood group)
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    100403307 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100403307 (SLC4A1)
   04147 Exosome [BR:cjc04147]
    100403307 (SLC4A1)
   04090 CD molecules [BR:cjc04090]
    100403307 (SLC4A1)
Transporters [BR:cjc02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100403307 (SLC4A1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100403307 (SLC4A1)
CD molecules [BR:cjc04090]
 Proteins
  100403307 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto DUF4579
Motif
Other DBs
NCBI-GeneID: 100403307
NCBI-ProteinID: XP_003732968
Ensembl: ENSCJAG00000010019
Position
5
AA seq 917 aa AA seqDB search
MDELQDDYEDVMEENLEQEEYEDPGVPEPQVEEPAAHDTEATATDYHTTSPRPGTHEVYV
ELQELVMDERNQELRWMEAARWVRLEENLGENGAWGRPHLSHLTFWSLLELQRVFSKGTV
LLDLQESSLAGVTNQLLDRFIYEEQIRPQDREELLRXLLLTHSHAGELEVLGGVKPAVLT
RSGDPSQPLLPQHPSLETQLFCEQGDGDAEGRSPSGILEKIPPDSEATLVLVGRATFLER
PVLGFVRLQEAVELEAVELPVPVRFLFVLLGPEDPHIDYTQLGRAAATLMSERVFRIDAY
MAQSRGELVRSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQLSPAKPDASFY
KGLDLNGGLGGPEGPDDPLQQTGQFFGGLVRDIRRRYPYYLSDITDALSPQVLAAVIFIY
FAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEE
AFFSFCESNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFI
YETFSKLIKIFQDHPLQKNYDYNVTTEPKPQGPLPNTALLSLVLMAGTFLFAMILRKFKN
SSYFPGKLRRVIGDFGVPISILIMVLVDFFIEDTYTQKLSVPDGLQVSNSSARGWVIHPL
GLRSHFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMG
GVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVSVLVGLS
ILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLLKPPKYHPDVPYVKRVKTWRM
HLFTGIQIICLVVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNLELQCLDADDAKA
AFDEDGQDEYDEVPMPV
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggatgagctgcaggatgattacgaagacgtgatggaggagaatctggagcaggaggaa
tatgaagacccaggagtccccgagcctcaggtggaggagccagcagctcacgacaccgag
gcaacagccacagactaccacaccacatcaccacgccctggtacccacgaggtctatgtg
gagctgcaggaactggtgatggacgaaaggaaccaggagctgagatggatggaggcggcg
cgctgggtgcgactggaggagaacctgggggagaacggggcctggggccgcccgcacctc
tctcacctcaccttctggagcctcctggagcttcagagagtcttcagcaagggtaccgtc
ctcctggacctgcaagagagctccctggcgggagtaaccaaccaactgctggacaggttt
atctatgaggagcagatccgacctcaggaccgagaggagctgctccggngcctgctgctc
acacacagccatgctggagagctcgaggtcctggggggcgtgaagcctgcagttctgacg
cgctctggggatccttcacagcctctgctcccccaacacccctcactggagacgcagctt
ttctgtgagcagggagacggggacgcagaagggcgctcaccatctggaattctggagaag
attcccccggattcagaggccacactggtgctagtgggccgtgccaccttcctggagcgg
cccgtgctgggctttgtgcggctgcaggaggcggtggagctggaggcagtggagctgccc
gtgcccgtgcgcttcctctttgtgttgctgggacccgaggacccccacattgattatacc
cagctcggccgggctgctgctaccctcatgtcggagagggtgttccgcatcgatgcgtac
atggctcagagccgaggggagctagtgcgctccttggagggcttcctggactgcagcctt
gtgctgcctcccacagacgccccctccgagcaggccctgctcagtctggtgcctgtgcag
agggagcttcttcgaaggcgctaccagctcagccctgccaagccagatgccagcttctac
aagggcctagacctaaatgggggcctagggggccccgagggaccagacgatcctctgcag
cagacaggccagttcttcgggggcttggtgcgtgacatccggcgccgctatccctactac
ctgagtgacatcacagatgcgttgagcccccaggtcctggctgctgtcatctttatctac
tttgctgccctgtcacctgccatcaccttcggtggcctcctgggagaaaagacccgaaac
cagatgggcgtgtctgagctgctgatctccactgcagtgcagggcattctcttcgccctg
ctgggggctcagcccctgctcgtggtcggcttctcaggaccactgctggtgtttgaggaa
gccttcttctcgttctgcgagagcaatggtctggagtacatcgtgggccgcgtgtggatc
ggcttctggctcatcctgctggtggtgttggtggtggcctttgagggcagctttctggtc
cgcttcatctcccgctacacccaggagatcttctccttcctcatctccctcatcttcatc
tatgagaccttctccaagctgatcaagatcttccaggaccacccactacagaagaattat
gactacaacgtgacaacagagcccaaacctcagggccccctgcccaacacagccctcctc
tcccttgtgctcatggccggtaccttcttatttgccatgatcctgcgcaagttcaagaac
agctcctacttcccgggcaagctacgtcgagtcatcggggacttcggggtccccatctcc
atcctgatcatggtcctggtggatttcttcattgaggatacctatacccagaaactctca
gtgcctgatggccttcaggtgtccaactcctcagcccggggctgggtcatccacccactg
ggcttgcgttcccactttcccatctggatgatgttcgcctccgccctgcctgctctgctg
gtcttcatcctcatattcctggagtctcagatcaccacgctgattgtcagcaaacccgag
cgcaagatggtcaagggctccggcttccacctggacctgttgctggtagtgggcatgggc
ggggtggctgccctctttgggatgccctggctcagtgccaccaccgtgcgttccgtcacc
cacgccaatgccctcactgtcatgggcaaagccagtaccccaggggctgcagcccagatc
caggaggtcaaagagcagcggatcagcgggctcctggtctctgtgcttgtgggcctgtcc
atcctcatggagcccatcctgtcccgcatccccctggctgtgctgtttggcatcttcctc
tacatgggggtcacatcgctcagcggcatccagctctttgaccgcatcctgcttctgctc
aagccacctaagtaccacccagatgtgccctacgtcaagcgggtgaagacctggcgcatg
cacctgttcacgggcatccagatcatctgcctggtagtgctgtgggtggtgaagtccacg
ccagcctcactggccctgcctttcgtcctcatcctcaccgtgcccctacggcgcgtcctg
ctgccgctcatcttcaggaacctggagcttcagtgtctggatgctgatgatgccaaggca
gcctttgatgaggacggtcaggatgaatatgacgaagtgcccatgcctgtgtga

DBGET integrated database retrieval system