KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403400Help
Entry
100403400         CDS       T03264                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04520  Adherens junction
cjc04910  Insulin signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04923  Regulation of lipolysis in adipocytes
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04960  Aldosterone-regulated sodium reabsorption
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100403400 (INSR)
   04015 Rap1 signaling pathway
    100403400 (INSR)
   04010 MAPK signaling pathway
    100403400 (INSR)
   04066 HIF-1 signaling pathway
    100403400 (INSR)
   04068 FoxO signaling pathway
    100403400 (INSR)
   04072 Phospholipase D signaling pathway
    100403400 (INSR)
   04022 cGMP - PKG signaling pathway
    100403400 (INSR)
   04151 PI3K-Akt signaling pathway
    100403400 (INSR)
   04152 AMPK signaling pathway
    100403400 (INSR)
   04150 mTOR signaling pathway
    100403400 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100403400 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100403400 (INSR)
   04923 Regulation of lipolysis in adipocyte
    100403400 (INSR)
   04913 Ovarian Steroidogenesis
    100403400 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100403400 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100403400 (INSR)
   04213 Longevity regulating pathway - multiple species
    100403400 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100403400 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100403400 (INSR)
   04931 Insulin resistance
    100403400 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100403400 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:cjc04090]
    100403400 (INSR)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100403400 (INSR)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100403400 (INSR)
CD molecules [BR:cjc04090]
 Proteins
  100403400 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 100403400
NCBI-ProteinID: XP_017823137
UniProt: U3FCC1
Position
22
AA seq 1382 aa AA seqDB search
MGAGSRRGAAAAPLLVAVAALLLGAAGQMYPGEVCPGMDIRNNLSRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VVFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTSKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPGDPTKCVACRNYYLDGRCVDSCPPPYYQFQDWRCVNFSFCQDLHYKCKNSQRQS
CYQYVIHNNKCLPECPSGYTMNSSNLMCTPCLGPCPKVCHLLDREKIIDSVTSAQDLRGC
TVINGSLIINIRGGNNLAVELEANLGLIEEISGYLKIRRSYALVSLAFFRKLRLIRGETL
EAGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEISGTKGRQE
KNDIALKTNGDQASCENELIKFSSIRTSSDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSSDPTSQSHPGWLMRNLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTAATNPSVPLDPISVSNSSSQIILKWKPPTDPNGNITHYLVFWQ
KQVEDSELFELDYCLKGLKLPSRTWSPPVESEGFQKHNQSEEEDLAGECCSCPKTDSQIQ
KELEESSFRKTFEDYLHNVVFIPRRTSPGPGAENSRPTRRRRSLDDTGNMTEAEPTVAVL
PNTSSTMEPMSPEEPKPFEKVVNRESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVSPVTHEILENNIVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFTLERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVSDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYIFLRKRQQDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNAKDVIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGIFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMEGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMENVPLDRSSHCQREEAGGRDGGSSLGLKRSYDEHIPYTHMNGGKKNGRILALPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgggagccgccggggggcggcggccgcgccgctgctggtggcggtggccgcg
ctgctcttgggcgccgcgggccaaatgtaccctggagaggtgtgccccggcatggacatc
cggaacaacctcagcaggctgcatgagctggagaattgctctgtcatcgaaggacactta
cagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagttttcccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaaa
gacctgttccccaacctcaccgtcatccggggatcgagactgttcttcaactatgcgctg
gtcgtcttcgagatggttcacctcaaggaactcggcctctacagcctgatgaacatcacc
cggggttccgtccggattgagaagaacaatgagctctgctacttggccactattgactgg
tcccgtatcctggattccgtggaggacaattacatcgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccaggtacctcgaagggcaagaccaactgccccgccaccgtc
atcaatgggcagtttgtcgaacggtgctggactcacagtcactgtcagaaagtttgcccg
accatctgtaagtcacacggctgcaccgcggaaggcctctgttgccatagtgagtgcttg
ggcaactgttctgagcccggcgaccccaccaagtgcgtggcctgccgcaactactacctg
gacggcaggtgtgtggactcctgcccgcccccgtactaccagttccaggactggcgctgc
gtgaacttcagcttctgccaggacctgcactacaaatgcaagaattcgcagaggcagagc
tgctaccagtacgtcattcacaacaacaagtgcctccccgagtgtccctctgggtacacg
atgaattccagcaacttgatgtgcaccccgtgcctgggtccctgtcccaaggtgtgccac
cttctagaccgcgagaaaatcatcgactcagtgacatctgcccaggatctccgaggatgc
accgtcatcaatgggagtctgatcatcaacatccgaggaggcaacaatctggcagttgag
ctagaagccaacctcggcctcattgaagaaatttcaggatatctaaaaatccgccgatcc
tacgcgctggtatcacttgccttctttcggaagttgcgtctgattcgaggagagaccttg
gaagccgggaactactccttctatgccttggacaatcagaacctaaggcagctctgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaaatttcaggaaccaaggggcgccaggag
aagaatgacattgccttaaagaccaatggggaccaagcatcctgtgaaaatgaattaatt
aaattttcttccattcggacaagttctgacaagatcttgctgaaatgggagccgtactgg
ccccccgacttccgagatctcttggggttcatgctgttctacaaagaagccccttatcag
aatgtgacggagttcgacgggcaggatgcttgtggttccaacagttggacggtggtagac
attgacccgccccagaggtccagtgaccccacatcacagagccacccaggatggctgatg
cggaatctcaagccctggacccagtatgctatctttgtgaagaccctggtcaccttttct
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagctgccacc
aacccgtccgtgccactggatccaatctcagtgtctaactcatcatcccagattattttg
aagtggaaaccccccacggaccccaatggcaacatcacccactacctggttttctggcag
aagcaggtggaagacagtgagctgttcgagttggattattgcctcaaagggttgaagttg
ccctcgaggacctggtctccaccagttgagtctgaaggttttcagaagcacaaccagagt
gaagaggaggatttggctggcgagtgttgctcctgtccgaagacagactctcagatccag
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaatgtggtt
ttcatccccagaagaacctctccaggccctggtgcggagaactctaggccgactcggaga
cgcaggtcccttgacgacactgggaacatgacggaggccgagcccacggtagcagttctc
cccaacacttcctcgaccatggagcccatgagtccagaggagcccaagcccttcgagaag
gtggtgaacagagagtcgctggtcatctctggcttgcgacacttcacgggctatcgaatt
gagctgcaggcttgcaaccaagacacccccgaggaacggtgcagtgtggcagcctatgtc
agcgccaggaccatgcctgaagccaaggctgatgacattgtcagccctgtgacccatgaa
atccttgagaacaacattgtccacttgatgtggcaggaaccaaaggaacccaatggtctg
atcgtgctttatgaagtgagttatcgacgatatggcgatgaggagctgcatctctgcgtc
tcccgcaagcacttcactctggaacggggctgcaggctgcgtgggctgtcgccggggaac
tacagcgtgcgagtccgggccacttccctggcgggcaacggctcctggacggaacctacc
tatttctatgtgtcagactacttagatgtcccatcaaatattgcaaaaattatcatcggc
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttatatattcctgaga
aagaggcagcaagatggaccactgggaccactttatgcttcttcaaaccctgagtatctc
agtgccagtgatgtgtttccatgctctgtgtacgtgccggacgagtgggaggtgcctcga
gagaagatcaccctccttcgtgagctggggcagggctcctttggcatggtgtatgaaggc
aacgccaaggatgtcatcaagggtgaggcagagacccgcgtggcggtgaagacggtcaac
gagtcagccagtctccgagagcggattgagttcctcaacgaggcctcagtcatgaagggc
ttcacctgccaccacgtggtgcgcctcctgggagtggtgtccaagggccagcccacactg
gtggtgatggagctgatggctcacggagacctgaagagctacctccgttctctgcggccg
gaggctgagaacaatcccggccgccctccccccaccctgcaagagatgattcagatggca
gcagagattgctgatgggatggcttacctgaacgccaagaagtttgtgcatcgggacctg
gcggccagaaactgcatggtcgcgcatgatttcactgtcaaaattggagactttggaatg
accagagacatctatgaaacggattactaccggaaagggggcaagggtctgctccctgtg
cggtggatggcaccggagtccctgaaggacgggatctttaccacttcttctgacatgtgg
tcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctg
tctaatgaacaagtgttgaaattcgtcatggaaggagggtatctggatcaacctgacaac
tgtccagagagagtgactgatctcatgcgtatgtgctggcaattcaaccccaagatgagg
ccaaccttcctagagattgtcaacttgctcaaggatgacctgcatcctagctttcccgag
gtgtccttctttcacagcgaggagaacaaggctcccgagagcgaggagctggagatggag
tttgaggatatggagaacgttcccctggatcgttcctctcactgtcagagggaggaggcc
gggggccgggatggagggtcctcactgggtctcaagaggagctacgacgaacacatcccc
tacacccacatgaatggaggcaagaagaacgggcggattctggccttgcctcgttccaac
ccttcctaa

DBGET integrated database retrieval system