KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403496Help
Entry
100403496         CDS       T03264                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04071  Sphingolipid signaling pathway
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04650  Natural killer cell mediated cytotoxicity
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100403496 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100403496 (BID)
   04215 Apoptosis - multiple species
    100403496 (BID)
   04217 Necroptosis
    100403496 (BID)
   04115 p53 signaling pathway
    100403496 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100403496 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403496 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100403496 (BID)
   05014 Amyotrophic lateral sclerosis (ALS)
    100403496 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100403496 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100403496 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100403496 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100403496 (BID)
   05162 Measles
    100403496 (BID)
   05164 Influenza A
    100403496 (BID)
   05161 Hepatitis B
    100403496 (BID)
   05160 Hepatitis C
    100403496 (BID)
   05168 Herpes simplex virus 1 infection
    100403496 (BID)
   05163 Human cytomegalovirus infection
    100403496 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100403496 (BID)
   05169 Epstein-Barr virus infection
    100403496 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100403496 (BID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BID Bcl-2 YebG
Motif
Other DBs
NCBI-GeneID: 100403496
NCBI-ProteinID: XP_009004700
Ensembl: ENSCJAG00000017295
Position
1
AA seq 212 aa AA seqDB search
MRSPPGHPEPGVSRRCTAQAMDCEVSNGSDLQDERITNLLVFGFLQSCSNHSFHRELEAL
GHELPQWEEPDEELQTDGNRSSHSHVGRIEADSESQEDVIRSIARHLAHIGDSMDRSIPL
DLVDRLALQLRNACRSEEDRRRDLASALEQLLQAHPTDMDKEKTMLVLALLLAKKVADHT
PSLLRDVFRTTVNFINQNLRAYVRSLTRNETD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgccgcctggacaccctgagccaggagtgagccgccgctgcactgcccaggcc
atggactgcgaggtcagcaatggttccgacctccaggatgagcgcatcacaaacctgctg
gtgtttggcttcctccaaagctgctccaaccacagcttccacagggagctggaggcgctg
ggccacgagctgccccagtgggaggagcccgatgaggagctgcagaccgacggcaaccgc
agcagccactcccacgtggggagaatagaggcagattctgaaagtcaagaagacgtcatc
cggagcattgccaggcacctcgcccacatcggggacagcatggaccgcagcatccccctg
gacctggtggaccgcctggccctgcagctcaggaacgcctgccggtcggaggaggaccgg
aggagggacctggccagtgccctggagcagctgctgcaggcccaccctacagacatggac
aaggagaagaccatgctggtgctggccctgctgctggccaagaaggtggccgatcacacg
ccgtccttactccgtgatgtcttccgcacaacagtgaatttcattaaccagaacctacgg
gcctacgtgaggagcttaaccagaaacgagacggactga

DBGET integrated database retrieval system