KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403544Help
Entry
100403544         CDS       T03264                                 

Gene name
MAOB
Definition
(RefSeq) monoamine oxidase B
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00260  Glycine, serine and threonine metabolism
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00380  Tryptophan metabolism
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
Module
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100403544 (MAOB)
   00330 Arginine and proline metabolism
    100403544 (MAOB)
   00340 Histidine metabolism
    100403544 (MAOB)
   00350 Tyrosine metabolism
    100403544 (MAOB)
   00360 Phenylalanine metabolism
    100403544 (MAOB)
   00380 Tryptophan metabolism
    100403544 (MAOB)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100403544 (MAOB)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100403544 (MAOB)
   04726 Serotonergic synapse
    100403544 (MAOB)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100403544 (MAOB)
   05031 Amphetamine addiction
    100403544 (MAOB)
   05034 Alcoholism
    100403544 (MAOB)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     100403544 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_oxidored DAO FAD_binding_2 FAD_binding_3 Thi4 Pyr_redox_2 Pyr_redox HI0933_like AlaDh_PNT_C GIDA Pyr_redox_3 IlvN Lycopene_cycl MCRA Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 100403544
NCBI-ProteinID: XP_002762853
Ensembl: ENSCJAG00000010763
UniProt: F7IRJ7
Position
X
AA seq 520 aa AA seqDB search
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQMVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHYVKGKSYPFRGPLPPVWNPITYLDCNNLWR
TLDDMGREIPSDAPWKAPHAEEWDHMTMKELLDKVCWTKSAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGITRIISTTSGGQERKFVGGSGQVTERIMDLLGDRVKLERPVIYIDQ
TGEYVLVETLNHEIYEATYVISAVPPALDMKIHFNPPLPMMRNQLITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMVIDGEEAPVAYTLDDTKPDGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSPEALEPVHYEEKNWCEEQYSGGCYTTYFPPGIMTQYGRVLRQPVDK
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTS
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaatgcgacgtggtcgtggtggggggcggcatctcaggtatggcagcagcc
aaacttctgcatgattctggactgaatgttgttgttctggaagcccgggaccgtgtggga
ggcaggacttacactcttaggaaccaaatggttaaatatgtggaccttggcggatcctat
gttgggccaacccagaatcgtatcttgagattagctaaggagctaggattggagacctac
aaagtgaatgaagttgagcgtctgatccactatgtaaagggcaaatcataccccttcaga
gggccgctcccacctgtatggaatccaattacctacttagattgtaacaacttgtggagg
acactggatgacatgggacgagagattcctagcgatgccccatggaaggctccccatgca
gaagaatgggaccacatgacaatgaaggagctgttggacaaggtctgctggactaaatct
gcaaagcagcttgccactctctttgtgaacttgtgtgtcaccgcagagacccatgaggtc
tctgctctctggttcctgtggtatgtgaagcagtgtggaggcataaccagaatcatctcg
acaaccagtggaggacaggagaggaaatttgtgggaggatctggtcaagtgactgagcgg
ataatggacctccttggggaccgagtgaagctggagaggcctgtgatctacattgaccag
acaggagaatatgtgcttgtggagaccctaaaccatgagatttatgaggctacatatgtg
attagtgctgttcctcctgctctggacatgaagattcacttcaatccccctctgccaatg
atgagaaaccagttgatcactcgtgtgcctttgggttcagtcatcaagtgtatagtttac
tataaagagcctttctggaggaaaaaggattactgtggaaccatggttattgatggagag
gaagctccagttgcctacacattggatgataccaaacctgatggcaactatgccgccata
atgggatttatcctggcccacaaagccagaaaactggcacgtcttaccaaagaggaaagg
ttgaagaaactttgtgaactctatgccaaagttctgggttccccagaagctctggagcca
gtccattatgaagagaagaactggtgtgaggagcagtactccggtggctgctacacgact
tacttcccccctgggatcatgactcaatatggaagggttctacgccagccagtggacaag
atttacttcgcaggcactgagactgccacacactggagcggctacatggagggggctgta
gaggctggggagagagcggcccgagagatcctgcatgctatggggaagattccagaggat
gaaatctggcagtcggaaccagagtctgtggatgtccctgcgcagcccatcaccacaagc
ttcttggagcgacatttgccctctgtgccaggcctgctcaggctgattggattgaccacc
atcttttcagcaacggctcttggcttcctggcccacaaaagggggctactcgtgcgagtc
taa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407187Help
Entry
100407187         CDS       T03264                                 

Gene name
MAOA
Definition
(RefSeq) monoamine oxidase A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00260  Glycine, serine and threonine metabolism
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00380  Tryptophan metabolism
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
Module
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100407187 (MAOA)
   00330 Arginine and proline metabolism
    100407187 (MAOA)
   00340 Histidine metabolism
    100407187 (MAOA)
   00350 Tyrosine metabolism
    100407187 (MAOA)
   00360 Phenylalanine metabolism
    100407187 (MAOA)
   00380 Tryptophan metabolism
    100407187 (MAOA)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100407187 (MAOA)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100407187 (MAOA)
   04726 Serotonergic synapse
    100407187 (MAOA)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100407187 (MAOA)
   05031 Amphetamine addiction
    100407187 (MAOA)
   05034 Alcoholism
    100407187 (MAOA)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     100407187 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 Pyr_redox_2 HI0933_like Pyr_redox FAD_binding_2 Pyr_redox_3 Thi4 FAD_oxidored AlaDh_PNT_C Lycopene_cycl GIDA MCRA TrkA_N Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 100407187
NCBI-ProteinID: XP_002762857
Ensembl: ENSCJAG00000010757
Position
X
AA seq 527 aa AA seqDB search
MTSQEKASIAGHMFDVVVIGGGISGLSAAKLLNEYGVNVLVLEARDRVGGRTHTVRNKHV
DYVDVGGAYVGPTQNRILRLAKELGIETYKVNVCERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPAEAPWEAPHANEWDKMTMKELIDKICWTATARRFASLFVNI
NVTSEPHEVSVLWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDRLGHRVKL
NHPVTHVDQSSDNVIIETLNHEHYECKYVISAIPPTLTAKIHFRPELPPERNQLIQRLPM
GAVIKCMMYYREAFWKKKDYCGCMIIEDEQAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEERKKKICELYAKVLGSQEALDPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVDKIFFAGTETATQWSGYMEGAVEAGERAAREVLHALGKVAKKDIWVQEPESKD
VPAVEITHTFWERNLPSVPGLMKIIGFTSSVTALGFTMYKYKLLPRF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgactagccaagagaaggcgagtatagcgggccacatgttcgacgtggtcgtgatcgga
ggtggcatttcaggtctttctgctgccaaactcttaaatgaatatggagttaacgttttg
gttttagaagctcgggacagggttggtggaagaacacatactgtgaggaacaaacatgtt
gattatgtggatgtaggtggagcctacgtgggaccaactcaaaacagaatattacgcttg
gctaaggagcttggcatagagacttataaagtgaatgtctgtgagcgtctcgttcaatat
gtcaaggggaaaacctatccatttcggggggcctttccaccagtatggaaccctattgca
tatttggactataacaacttgtggcgaactatggataacatgggaaaggagattccagct
gaggctccctgggaggccccacatgctaacgaatgggacaaaatgactatgaaagagctc
attgataaaatctgctggacagcgactgctaggcgttttgcttctctttttgtgaatatc
aatgtaacctctgagcctcatgaggtatcagttctatggtttttatggtatgtgaagcag
tgcgggggcaccactcggatattctctgtcaccaatggcggccaggaacggaagtttgta
ggtggatctggtcaagtgagcgaacggataatggaccgcctcgggcaccgagtgaagcta
aaccatcctgtcactcatgttgaccaatcaagtgacaatgtcatcatagagacattgaac
cacgaacattatgagtgcaaatacgtaattagtgcgatccccccgactttgaccgccaaa
attcacttcagaccagagcttccaccagagaggaaccagttaattcagcgtcttccaatg
ggagctgtcattaagtgcatgatgtattacagggaggctttctggaagaagaaggattat
tgtggttgtatgatcattgaggatgaacaggctccaatttcaataaccttggatgacacc
aagccagacggctcactgcctgccatcatgggcttcattcttgcccggaaagccgatcga
cttgctaagcttcataaagaagaaaggaagaagaaaatctgtgagctctatgcgaaagtg
ctaggatcccaagaagctttagatccagtgcattatgaagagaagaactggtgtgaggag
cagtactctgggggctgctacacggcctattttccgcctgggatcatgactcagtatgga
agggtgattcgtcaacccgtggataagattttttttgctggcacggagactgccacacag
tggagcggctacatggaaggggcagttgaggctggagaacgagcagccagggaggttttg
catgcacttgggaaggtggccaagaaagacatctgggtacaagaacctgaatcaaaggat
gttccagcggtagaaatcacccacaccttttgggagagaaacctgccatctgttcctggc
ctcatgaaaatcattggatttacctcatcagtaactgccttagggtttactatgtacaaa
tacaagctactgccacggttttga

DBGET integrated database retrieval system